1TUI: Intact elongation factor tu

Name: PDB 1TUI: Intact elongation factor tu in complex with GDP
Published: 1997-06-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: elongation factor

Intact elongation factor tu in complex with GDP. Determined by X-ray diffraction at 2.7 Å resolution. Released 5 Jun 1997.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Thermus aquaticus
Chains: 3
Atoms: 9,422
Mol. weight: 135.63 kDa
Ligands: MG, GDP
Released: 5 Jun 1997

Explore 1TUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TUI contains 43 α-helices and 84 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
β-strand	16-17	2	2
α-helix	24-38	15
α-helix	47-51	5
α-helix	53-55	3
β-strand	57-58	2	3
β-strand	61-62	2	3
β-strand	66-71	6	1
β-strand	76-81	6	1
α-helix	85-94	10
β-strand	102-107	6	2
α-helix	114-122	9
α-helix	123-127	5
β-strand	131-136	6	2
α-helix	138-140	3
α-helix	144-160	17
β-strand	170-172	3	2
α-helix	175-184	10
α-helix	194-209	16
α-helix	211-215	5
α-helix	216-218	3
α-helix	220-221	2
β-strand	222-224	3	4
β-strand	227-231	5	5
β-strand	235-241	7	5
β-strand	244	1	4
β-strand	246-248	3	6
β-strand	252-256	5	4
β-strand	263-266	4	4
β-strand	267-269	3	5
β-strand	279-281	3	6
β-strand	285-290	6	5
β-strand	303-305	3	4
β-strand	311-322	12	7
β-strand	334	1	8
β-strand	341-344	4	7
β-strand	347-354	8	7
α-helix	355-356	2
β-strand	362	1	8
β-strand	367-380	14	7
β-strand	385-390	6	7
β-strand	393-403	11	7

Chain B: 15 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	9
β-strand	16-17	2	10
α-helix	24-38	15
α-helix	47-51	5
α-helix	53-55	3
β-strand	57-58	2	11
β-strand	61-62	2	11
β-strand	66-71	6	9
β-strand	76-81	6	9
α-helix	85-94	10
β-strand	102-107	6	10
α-helix	114-126	13
β-strand	131-136	6	10
α-helix	138-140	3
α-helix	144-160	17
β-strand	170-172	3	10
α-helix	175-184	10
α-helix	194-209	16
α-helix	211-215	5
α-helix	216-218	3
α-helix	220-221	2
β-strand	222-224	3	12
β-strand	227-231	5	13
β-strand	235-241	7	13
β-strand	244	1	12
β-strand	246-248	3	14
β-strand	252-256	5	12
β-strand	263-266	4	12
β-strand	267-269	3	13
β-strand	279-281	3	14
β-strand	285-290	6	13
β-strand	303-305	3	12
β-strand	311-322	12	15
α-helix	323-324	2
α-helix	325-327	3
β-strand	334	1	16
β-strand	341-344	4	15
β-strand	347-354	8	15
α-helix	355-356	2
β-strand	362	1	16
β-strand	367-380	14	15
β-strand	385-390	6	15
β-strand	393-403	11	15

Chain C: 14 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	17
β-strand	16-17	2	18
α-helix	24-38	15
α-helix	47-51	5
α-helix	53-55	3
β-strand	57-58	2	19
β-strand	61-62	2	19
β-strand	66-71	6	17
β-strand	76-81	6	17
α-helix	85-90	6
α-helix	91-95	5
β-strand	102-107	6	18
α-helix	114-126	13
β-strand	131-136	6	18
α-helix	138-140	3
α-helix	144-160	17
β-strand	170-172	3	18
α-helix	175-184	10
α-helix	194-209	16
α-helix	211-215	5
α-helix	216-218	3
α-helix	220-221	2
β-strand	222-224	3	20
β-strand	227-231	5	21
β-strand	235-241	7	21
β-strand	244	1	20
β-strand	246-248	3	22
β-strand	252-256	5	20
β-strand	263-266	4	20
β-strand	267-269	3	21
β-strand	279-281	3	22
β-strand	285-290	6	21
β-strand	303-305	3	20
β-strand	311-322	12	23
β-strand	334	1	24
β-strand	341-344	4	23
β-strand	347-354	8	23
α-helix	355-356	2
β-strand	362	1	24
β-strand	367-380	14	23
β-strand	385-390	6	23
β-strand	393-403	11	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor tu	A, B, C	protein	405	Thermus aquaticus	Q01698 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1TUI_1 ELONGATION FACTOR TU (chains A, B, C)
AKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPEERARG
ITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALE
EMHKNPKTKRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVER
GQVLAKPGSITPHTKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVTGVVRLPQGVE
MVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	3

Primary citation

Helix unwinding in the effector region of elongation factor EF-Tu-GDP. Polekhina, G., Thirup, S., Kjeldgaard, M. et al. Structure (1996) 4:1141-1151. DOI 10.1016/S0969-2126(96)00122-0 · PubMed

Other PDB entries of the same protein (UniProt Q01698 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EFT 2.5 Å, The crystal structure of elongation factor ef-tu from thermus aquaticus in the GTP…
1B23 2.6 Å, E. coli cysteinyl-tRNA and T. aquaticus elongation factor EF-TU:GTP ternary complex
1TTT 2.7 Å, Phe-tRNA, elongation factoR EF-TU:GDPNP ternary complex
1OB5 3.1 Å, T. aquaticus elongation factor EF-Tu complexed with the antibiotic enacyloxin IIa, a GTP…

Browse structure collections

About this viewer

MolViewer shows 1TUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.