1U2R: Elongation factor 2

Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Sept 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 6,670
Mol. weight: 95.07 kDa
Ligands: MG, APR, SO1, GDP
Released: 14 Sept 2004

Explore 1U2R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U2R contains 44 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
α-helix	6-12	7
α-helix	16-18	3
β-strand	19-26	8	2
α-helix	32-43	12
β-strand	44	1	2
β-strand	47	1	1
β-strand	70	1	3
β-strand	74-80	7	2
α-helix	83-88	6
β-strand	97-103	7	2
α-helix	113-120	8
β-strand	124-130	7	2
β-strand	134	1	2
α-helix	137-147	11
α-helix	151	1
β-strand	152-158	7	2
α-helix	160-165	6
α-helix	171-192	22
α-helix	195-197	3
α-helix	204-206	3
β-strand	209-213	5	2
β-strand	218-221	4	2
α-helix	222-233	12
α-helix	237-243	7
β-strand	249-251	3	4
β-strand	256-258	3	4
β-strand	262	1	5
β-strand	268	1	5
β-strand	271	1	4
α-helix	272-273	2
α-helix	274-278	5
α-helix	279-289	11
α-helix	296-302	7
α-helix	309-313	5
α-helix	316-327	12
β-strand	329	1	2
α-helix	330-341	12
α-helix	343-344	2
α-helix	345-356	12
β-strand	357	1	6
α-helix	364-370	7
β-strand	379-387	9	7
β-strand	388	1	3
β-strand	394-402	9	7
β-strand	404-406	3	8
β-strand	410-414	5	7
β-strand	426-430	5	7
β-strand	433-438	6	7
β-strand	441-445	5	7
β-strand	447-449	3	8
β-strand	453-457	5	7
β-strand	467-470	4	7
α-helix	476-477	2
β-strand	478	1	6
α-helix	480-482	3
β-strand	489-495	7	9
α-helix	498-500	3
α-helix	501-514	14
β-strand	519-522	4	9
β-strand	528-532	5	9
α-helix	535-544	10
α-helix	545-549	5
β-strand	554-557	4	9
α-helix	558-562	5
β-strand	564-567	4	10
β-strand	575-578	4	11
β-strand	585-592	8	11
α-helix	593-594	2
α-helix	595-603	9
α-helix	612-621	10
α-helix	627-631	5
β-strand	633-636	4	11
β-strand	644-648	5	11
α-helix	656-672	17
α-helix	679	1
β-strand	680-681	2	10
β-strand	684-692	9	11
α-helix	697-699	3
α-helix	702-718	17
β-strand	722-735	14	10
α-helix	737-749	13
β-strand	753-758	6	10
β-strand	766-773	8	10
α-helix	774-776	3
α-helix	780-787	8
β-strand	793	1	10
β-strand	796-803	8	10
α-helix	814-825	12
α-helix	832-834	3
α-helix	835-838	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor 2	A	protein	842	Saccharomyces cerevisiae	P32324 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U2R_1 Elongation factor 2 (chains A)
MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTR
KDEQERGITIKSTAISLYSEMSDEDVKEIKQKTDGNSFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDLYQTFAR
TVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKM
MDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLL
EKLEIVLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGP
ADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYVP
GKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSETAHNMKV
MKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEI
CLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLA
IENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIK
DSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLA
DPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGF
TGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYD
KL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
APR	Adenosine-5-diphosphoribose	C15 H23 N5 O14 P2	1
SO1	[1R-(1.ALPHA.,3A.BETA.,4.BETA.,4A.BETA.,7.BETA.,7A.ALPHA.,8A.BETA.)]8A-[(6-deox…	C27 H42 O8	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae. Jorgensen, R., Yates, S.P., Teal, D.J. et al. J Biol Chem (2004) 279:45919-45925. DOI 10.1074/jbc.M406218200 · PubMed

Other PDB entries of the same protein (UniProt P32324 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CDR 2.04 Å, Translocation intermediate 2 (TI-2) of 80S S. cerevisiae ribosome with ligands and eEF2…
1N0U 2.12 Å, Crystal structure of yeast elongation factor 2 in complex with sordarin
3B82 2.35 Å, Structure of the eEF2-ExoA(E546H)-NAD+ complex
3B78 2.5 Å, Structure of the eEF2-ExoA(R551H)-NAD+ complex
3B8H 2.5 Å, Structure of the eEF2-ExoA(E546A)-NAD+ complex
8EUB 2.52 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
8EVS 2.62 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
8EVQ 2.72 Å, Hypopseudouridylated Ribosome bound with TSV IRES, eEF2, GDP, and sordarin, Structure I
1ZM9 2.8 Å, Structure of eEF2-ETA in complex with PJ34
1N0V 2.85 Å, Crystal structure of elongation factor 2
8T3A 2.86 Å, Hypomethylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome entry…
8EVR 2.87 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…

Browse structure collections

About this viewer

MolViewer shows 1U2R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.