Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana with AMPPNP bound. Determined by X-ray diffraction at 2.45 Å resolution. Released 24 Aug 2004.
Explore 1U3D in 3D Show helices and sheets RCSB PDB PDBe
1U3D contains 31 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-18 | 5 | 1 |
| α-helix | 28-36 | 9 | |
| β-strand | 39-45 | 7 | 1 |
| α-helix | 47-50 | 4 | |
| α-helix | 54-56 | 3 | |
| α-helix | 57-76 | 20 | |
| β-strand | 81-85 | 5 | 1 |
| α-helix | 89-100 | 12 | |
| β-strand | 104-108 | 5 | 1 |
| α-helix | 113-127 | 15 | |
| β-strand | 132-136 | 5 | 1 |
| α-helix | 144-146 | 3 | |
| α-helix | 153-155 | 3 | |
| α-helix | 158-166 | 9 | |
| α-helix | 171-174 | 4 | |
| α-helix | 176-179 | 4 | |
| β-strand | 184 | 1 | 1 |
| α-helix | 187-189 | 3 | |
| α-helix | 200-206 | 7 | |
| α-helix | 209-212 | 4 | |
| α-helix | 217-228 | 12 | |
| α-helix | 231-234 | 4 | |
| α-helix | 251-255 | 5 | |
| α-helix | 261-278 | 18 | |
| α-helix | 281-305 | 25 | |
| α-helix | 328-336 | 9 | |
| α-helix | 342-354 | 13 | |
| α-helix | 359-371 | 13 | |
| α-helix | 377-387 | 11 | |
| α-helix | 393-404 | 12 | |
| α-helix | 410-412 | 3 | |
| α-helix | 419-426 | 8 | |
| α-helix | 431-436 | 6 | |
| α-helix | 438-440 | 3 | |
| α-helix | 445-448 | 4 | |
| α-helix | 456-462 | 7 | |
| β-strand | 466 | 1 | 2 |
| β-strand | 470 | 1 | 2 |
| α-helix | 477-495 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome 1 apoprotein | A | protein | 509 | Arabidopsis thaliana | Q43125 (AlphaFold model) |
>1U3D_1 Cryptochrome 1 apoprotein (chains A) MSGSVSGCGSGGCSIVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSR WWLKNSLAQLDSSLRSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDH RAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPPK KIISGDVSKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRR KADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYS RYISFNHPYSHERPLLGHLKFFPWAVDENYFKAWRQGRTGYPLVDAGMRELWATGWLHDR IRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGTLPDSREFDRIDNPQ FEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEA KARLHEALSQMWQLEAASRAAIENGSEEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 4 |
| FAD | Flavin-adenine dinucleotide | C27 H33 N9 O15 P2 | 1 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
| NDS | Ethyl dimethyl ammonio propane sulfonate | C7 H17 N O3 S | 1 |
Water and common crystallization additives (CL) are not listed.
Structure of the photolyase-like domain of cryptochrome 1 from Arabidopsis thaliana. Brautigam, C.A., Smith, B.S., Ma, Z. et al. Proc Natl Acad Sci U S A (2004) 101:12142-12147. DOI 10.1073/pnas.0404851101 · PubMed
Other PDB entries of the same protein (UniProt Q43125 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1U3D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.