1U5T: ESCRT-II endosomal trafficking complex

Structure of the ESCRT-II endosomal trafficking complex. Determined by X-ray diffraction at 3.6 Å resolution. Released 21 Sept 2004.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 6,055
Mol. weight: 93.81 kDa
Released: 21 Sept 2004

Explore 1U5T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U5T contains 34 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	23-49	27
α-helix	58-71	14
α-helix	75-78	4
α-helix	83-85	3
α-helix	88-106	19
β-strand	114-115	2	1
α-helix	116-121	6
α-helix	131-141	11
β-strand	149-152	4	1
β-strand	155-158	4	1
α-helix	169-174	6
β-strand	183	1	2
α-helix	184-191	8
α-helix	196-207	12
β-strand	212-214	3	2
β-strand	222-224	3	2
α-helix	226-230	5

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	407-420	14
β-strand	435-436	2	3
α-helix	439-446	8
α-helix	457-464	8
α-helix	468-470	3
β-strand	476-480	5	3
β-strand	484-488	5	3
α-helix	493-505	13
β-strand	509	1	4
α-helix	511-519	9
α-helix	529-538	10
α-helix	539-543	5
β-strand	545-549	5	4
β-strand	554-558	5	4

Chain C: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	11-14	4
α-helix	20-38	19
β-strand	45-46	2	5
α-helix	87-98	12
β-strand	103-105	3	5
β-strand	121-123	3	5
α-helix	128-142	15
β-strand	148-149	2	6
α-helix	151-154	4
α-helix	170-177	8
β-strand	187-188	2	6
β-strand	197-198	2	6

Chain D: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	11-13	3
α-helix	20-38	19
β-strand	45-46	2	7
α-helix	87-100	14
β-strand	105	1	7
β-strand	121-122	2	7
α-helix	129-132	4
β-strand	149	1	8
α-helix	151-154	4
α-helix	170-177	8
α-helix	180-182	3
β-strand	188	1	8
β-strand	197	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
appears to be functionally related to SNF7; Snf8p	A	protein	233	Saccharomyces cerevisiae	Q12483 (AlphaFold model)
Defective in vacuolar protein sorting; Vps36p	B	protein	169	Saccharomyces cerevisiae	Q06696 (AlphaFold model)
Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region	C, D	protein	202	Saccharomyces cerevisiae	P47142 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U5T_1 appears to be functionally related to SNF7; Snf8p (chains A)
MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEF
RSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELE
KVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILG
YSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL

Sequence of entity 2 (B), FASTA

>1U5T_2 Defective in vacuolar protein sorting; Vps36p (chains B)
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLI
SPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLT
QILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPS

Sequence of entity 3 (C, D), FASTA

>1U5T_3 Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region (chains C, D)
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDNELDS
GSTDNDDSKKISKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTR
YFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPL
CDRNRATMLKDENDKVIAIKVV

Primary citation

Structure of ESCRT-II endosomal trafficking complex. Hierro, A., Sun, J., Rusnak, A.S. et al. Nature (2004) 431:221-225. DOI 10.1038/nature02914 · PubMed

Other PDB entries of the same protein (UniProt Q12483 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W7P 3.6 Å, The crystal structure of endosomal complex ESCRT-II (VPS22/VPS25/VPS36)

Browse structure collections

About this viewer

MolViewer shows 1U5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.