The Crystal structure of murine APRIL, pH 8.5. Determined by X-ray diffraction at 2.4 Å resolution. Released 12 Oct 2004.
Explore 1U5Z in 3D Show helices and sheets RCSB PDB PDBe
1U5Z contains 0 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 108-117 | 10 | 1 |
| β-strand | 125-135 | 11 | 1 |
| β-strand | 139-142 | 4 | 1 |
| β-strand | 145-148 | 4 | 1 |
| β-strand | 152-162 | 11 | 1 |
| β-strand | 169-176 | 8 | 1 |
| β-strand | 181-189 | 9 | 1 |
| β-strand | 200-210 | 11 | 1 |
| β-strand | 215-220 | 6 | 1 |
| β-strand | 227 | 1 | 1 |
| β-strand | 235-240 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor ligand superfamily member 13 | A | protein | 140 | Mus musculus | Q9D777 (AlphaFold model) |
>1U5Z_1 Tumor necrosis factor ligand superfamily member 13 (chains A) GSKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVL FHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIP RANAKLSLSPHGTFLGFVKL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 1 |
The Crystal Structure of A Proliferation-inducing Ligand, APRIL. Wallweber, H.J., Compaan, D.M., Starovasnik, M.A. et al. J Mol Biol (2004) 343:283-290. DOI 10.1016/j.jmb.2004.08.040 · PubMed
Other PDB entries of the same protein (UniProt Q9D777 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1U5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.