1U5Z: Murine APRIL, pH 8.5

The Crystal structure of murine APRIL, pH 8.5. Determined by X-ray diffraction at 2.4 Å resolution. Released 12 Oct 2004.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,007
Mol. weight: 15.76 kDa
Ligands: NI
Released: 12 Oct 2004

Explore 1U5Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U5Z contains 0 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	108-117	10	1
β-strand	125-135	11	1
β-strand	139-142	4	1
β-strand	145-148	4	1
β-strand	152-162	11	1
β-strand	169-176	8	1
β-strand	181-189	9	1
β-strand	200-210	11	1
β-strand	215-220	6	1
β-strand	227	1	1
β-strand	235-240	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 13	A	protein	140	Mus musculus	Q9D777 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U5Z_1 Tumor necrosis factor ligand superfamily member 13 (chains A)
GSKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVL
FHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIP
RANAKLSLSPHGTFLGFVKL

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Primary citation

The Crystal Structure of A Proliferation-inducing Ligand, APRIL. Wallweber, H.J., Compaan, D.M., Starovasnik, M.A. et al. J Mol Biol (2004) 343:283-290. DOI 10.1016/j.jmb.2004.08.040 · PubMed

Other PDB entries of the same protein (UniProt Q9D777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U5X 1.8 Å, Crystal structure of murine APRIL at pH 5.0
1XU1 1.9 Å, The crystal structure of APRIL bound to TACI
1U5Y 2.3 Å, Crystal structure of murine APRIL, pH 8.0
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
3K48 2.8 Å, Crystal structure of APRIL bound to a peptide

Browse structure collections

About this viewer

MolViewer shows 1U5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.