1UHJ: Br-aequorin

Crystal structure of br-aequorin. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Feb 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Aequorea victoria
Chains: 2
Atoms: 3,468
Mol. weight: 44.83 kDa
Ligands: CZB
Released: 8 Feb 2005

Explore 1UHJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UHJ contains 23 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	30-32	3	1
α-helix	33-41	9
α-helix	42-47	6
α-helix	52-68	17
β-strand	76-78	3	1
α-helix	79-98	20
α-helix	104-116	13
β-strand	123-124	2	2
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	2
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	30-32	3	3
α-helix	33-41	9
α-helix	42-47	6
α-helix	52-68	17
β-strand	76-78	3	3
α-helix	79-98	20
α-helix	104-116	13
β-strand	123-124	2	4
α-helix	126-136	11
α-helix	142-151	10
α-helix	153-154	2
β-strand	160-161	2	4
α-helix	162-174	13
α-helix	178-180	3
α-helix	185-187	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aequorin 2	A, B	protein	191	Aequorea victoria	P02592 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UHJ_1 Aequorin 2 (chains A, B)
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRH
KDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDK
DQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDP
ACEKLYGGAVP

Ligands and cofactors

ID	Name	Formula	Copies
CZB	(2S,8R)-8-benzyl-2-(4-bromobenzyl)-2-hydroperoxy-6-(4-hydroxyphenyl)-7,8-dihydr…	C26 H22 Br N3 O4	2

Primary citation

The crystal structures of semi-synthetic aequorins. Toma, S., Chong, K.T., Nakagawa, A. et al. Protein Sci (2005) 14:409-416. DOI 10.1110/ps.041067805 · PubMed

Other PDB entries of the same protein (UniProt P02592 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UHK 1.6 Å, Crystal structure of n-aequorin
1UHH 1.8 Å, Crystal structure of cp-aequorin
1UHI 1.8 Å, Crystal structure of i-aequorin
7EG3 2.09 Å, Crystal structure of the apoAequorin complex with (S)-HM-daCTZ
5ZAB 2.15 Å, Crystal structure of cf3-aequorin
7EG2 2.22 Å, Crystal structure of the apoAequorin complex with (S)-daCTZ
1EJ3 2.3 Å, Crystal structure of aequorin

Browse structure collections

About this viewer

MolViewer shows 1UHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.