1UKH: Mitogen-activated protein kinase 8 isoform 4

Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125. Determined by X-ray diffraction at 2.35 Å resolution. Released 30 Aug 2004.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,767
Mol. weight: 43.93 kDa
Released: 30 Aug 2004

Explore 1UKH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UKH contains 19 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	18-23	6	1
β-strand	26-34	9	2
β-strand	38-45	8	2
β-strand	50-57	8	2
α-helix	64-79	16
β-strand	85	1	3
α-helix	86-87	2
β-strand	88-92	5	2
β-strand	105-109	5	2
β-strand	113-114	2	3
α-helix	115-118	4
α-helix	125-143	19
β-strand	157-159	3	3
β-strand	165-167	3	3
α-helix	194-197	4
α-helix	206-220	15
α-helix	230-241	12
α-helix	243-245	3
α-helix	246-250	5
α-helix	254-260	7
α-helix	271-274	4
α-helix	277-279	3
α-helix	288-301	14
α-helix	306-308	3
α-helix	310-311	2
α-helix	312-317	6
α-helix	322-324	3
α-helix	327-330	4
α-helix	351-361	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 8 isoform 4	A	protein	369	Homo sapiens	P45983 (AlphaFold model)
11-mer peptide from C-jun-amino-terminal kinase interacting protein 1	B	protein	11		Q9WVI9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UKH_1 Mitogen-activated protein kinase 8 isoform 4 (chains A)
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLHHHHHH

Sequence of entity 2 (B), FASTA

>1UKH_2 11-mer peptide from C-jun-amino-terminal kinase interacting protein 1 (chains B)
RPKRPTTLNLF

Primary citation

Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125. Heo, Y.-S., Kim, S.K., Seo, C.I. et al. EMBO J (2004) 23:2185-2195. DOI 10.1038/sj.emboj.7600212 · PubMed

Other PDB entries of the same protein (UniProt P45983 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XRW 1.33 Å, Linear binding motifs for JNK and for calcineurin antagonistically control the nuclear…
12CV 1.5 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-2728
4QTD 1.5 Å, Structure of human JNK1 in complex with SCH772984 and the AMPPNP-hydrolysed triphosphate…
11ZL 1.55 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-3013
8R5E 1.7 Å, JNK1 covalently bound to RU77 cyclohexenone based inhibitor
3ELJ 1.8 Å, Jnk1 complexed with a bis-anilino-pyrrolopyrimidine inhibitor.
4AWI 1.91 Å, Human Jnk1alpha kinase with 4-phenyl-7-azaindole IKK2 inhibitor.
4L7F 1.95 Å, Co-crystal Structure of JNK1 and AX13587
3PZE 2.0 Å, JNK1 in complex with inhibitor
8X5M 2.0 Å, The Crystal Structure of JNK1 from Biortus.
4HYU 2.15 Å, Crystal structure of JNK1 in complex with JIP1 peptide and…
4E73 2.27 Å, Crystal structure of JNK1beta-JIP in complex with an azaquinolone inhbitor

Browse structure collections

About this viewer

MolViewer shows 1UKH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.