1UKI: Mitogen-activated protein kinase 8 isoform 4

Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125. Determined by X-ray diffraction at 2.7 Å resolution. Released 30 Aug 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,763
Mol. weight: 44.15 kDa
Ligands: 537
Released: 30 Aug 2004

Explore 1UKI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UKI contains 19 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	18-23	6	1
β-strand	26-31	6	2
β-strand	39-45	7	2
β-strand	52-58	7	2
α-helix	64-79	16
β-strand	88-92	5	2
β-strand	103-109	7	2
β-strand	113-114	2	3
α-helix	125-143	19
α-helix	154-156	3
β-strand	158-159	2	3
β-strand	165	1	3
α-helix	194	1
α-helix	195-199	5
α-helix	204-206	3
α-helix	207-219	13
α-helix	230-240	11
α-helix	246-251	6
α-helix	254-261	8
α-helix	271-274	4
α-helix	277-279	3
α-helix	290-301	12
α-helix	306-308	3
α-helix	312-317	6
α-helix	322-324	3
α-helix	332-334	3
α-helix	349-361	13

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	155-157	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mitogen-activated protein kinase 8 isoform 4	A	protein	369	Homo sapiens	P45983 (AlphaFold model)
11-mer peptide from C-jun-amino-terminal kinase interacting protein 1	B	protein	11		Q9WVI9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UKI_1 mitogen-activated protein kinase 8 isoform 4 (chains A)
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLHHHHHH

Sequence of entity 2 (B), FASTA

>1UKI_2 11-mer peptide from C-jun-amino-terminal kinase interacting protein 1 (chains B)
RPKRPTTLNLF

Ligands and cofactors

ID	Name	Formula	Copies
537	2,6-DIHYDROANTHRA/1,9-cd/pyrazol-6-one	C14 H8 N2 O	1

Primary citation

Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125. Heo, Y.-S., Kim, S.K., Seo, C.I. et al. EMBO J (2004) 23:2185-2195. DOI 10.1038/sj.emboj.7600212 · PubMed

Other PDB entries of the same protein (UniProt P45983 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XRW 1.33 Å, Linear binding motifs for JNK and for calcineurin antagonistically control the nuclear…
12CV 1.5 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-2728
4QTD 1.5 Å, Structure of human JNK1 in complex with SCH772984 and the AMPPNP-hydrolysed triphosphate…
11ZL 1.55 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-3013
8R5E 1.7 Å, JNK1 covalently bound to RU77 cyclohexenone based inhibitor
3ELJ 1.8 Å, Jnk1 complexed with a bis-anilino-pyrrolopyrimidine inhibitor.
4AWI 1.91 Å, Human Jnk1alpha kinase with 4-phenyl-7-azaindole IKK2 inhibitor.
4L7F 1.95 Å, Co-crystal Structure of JNK1 and AX13587
3PZE 2.0 Å, JNK1 in complex with inhibitor
8X5M 2.0 Å, The Crystal Structure of JNK1 from Biortus.
4HYU 2.15 Å, Crystal structure of JNK1 in complex with JIP1 peptide and…
4E73 2.27 Å, Crystal structure of JNK1beta-JIP in complex with an azaquinolone inhbitor

Browse structure collections

About this viewer

MolViewer shows 1UKI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.