1UOC: RNase domain of the yeast Pop2 protein

X-ray structure of the RNase domain of the yeast Pop2 protein. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Nov 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 4,263
Mol. weight: 67.03 kDa
Ligands: XE, CA
Released: 20 Nov 2003

Explore 1UOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UOC contains 32 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
β-strand	17-19	3	1
α-helix	24-34	11
β-strand	40-48	9	1
α-helix	61-73	13
β-strand	77-86	10	1
β-strand	99-103	5	1
β-strand	104	1	2
α-helix	115-123	9
α-helix	128-134	7
α-helix	135	1
β-strand	136	1	2
α-helix	137	1
α-helix	138-146	9
β-strand	157-160	4	1
α-helix	165-174	10
α-helix	183-193	11
β-strand	197-199	3	1
α-helix	200-207	8
α-helix	229-235	7
α-helix	242-245	4
α-helix	247-264	18
β-strand	268	1	3
β-strand	274	1	3
α-helix	275-278	4

Chain B: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
β-strand	17-19	3	4
α-helix	21-23	3
α-helix	24-35	12
β-strand	40-48	9	4
α-helix	63-72	10
α-helix	73-75	3
β-strand	77-86	10	4
β-strand	99-103	5	4
β-strand	104	1	5
α-helix	115-124	10
α-helix	128-134	7
α-helix	135	1
β-strand	136	1	5
α-helix	137	1
α-helix	138-146	9
β-strand	157-160	4	4
α-helix	164-173	10
α-helix	183-193	11
β-strand	197-199	3	4
α-helix	200-206	7
α-helix	229-236	8
α-helix	242-245	4
α-helix	247-264	18
β-strand	268	1	6
β-strand	274	1	6
α-helix	275-278	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
POP2	A, B	protein	289	SACCHAROMYCES CEREVISIAE	P39008 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UOC_1 POP2 (chains A, B)
GAMPPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS
KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLEL
LRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMP
NNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNPQLQQSSQQQQQQQYSLTTLADELGLPR
FSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ

Ligands and cofactors

ID	Name	Formula	Copies
XE	Xenon	Xe	2
CA	Calcium ion	Ca	2

Primary citation

X-Ray Structure and Activity of the Yeast Pop2 Protein: A Nuclease Subunit of the Mrna Deadenylase Complex. Thore, S., Mauxion, F., Seraphin, B. et al. EMBO Rep (2003) 4:1150. DOI 10.1038/SJ.EMBOR.7400020 · PubMed

Other PDB entries of the same protein (UniProt P39008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4B8A 2.4 Å, Structure of yeast NOT1 MIF4G domain co-crystallized with CAF1
4B8C 3.41 Å, nuclease module of the yeast Ccr4-Not complex

Browse structure collections

About this viewer

MolViewer shows 1UOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.