1UQ5: Ricin a-chain (recombinant) N122A mutant

Ricin a-chain (recombinant) N122A mutant. Determined by X-ray diffraction at 1.4 Å resolution. Released 2 Jan 2004.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: RICINUS COMMUNIS
Chains: 1
Atoms: 2,596
Mol. weight: 29.66 kDa
Released: 2 Jan 2004

Explore 1UQ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UQ5 contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	18-32	15
β-strand	38-39	2	2
β-strand	42-43	2	2
β-strand	44	1	3
α-helix	45-47	3
α-helix	53-55	3
β-strand	57-63	7	1
β-strand	69-75	7	1
β-strand	81-86	6	1
β-strand	89-92	4	1
α-helix	93-95	3
α-helix	98-104	7
β-strand	113-116	4	1
α-helix	123-130	8
α-helix	134-136	3
β-strand	139	1	4
α-helix	141-153	13
α-helix	154-156	3
α-helix	161-171	11
α-helix	172-177	6
α-helix	178-180	3
α-helix	182-193	12
β-strand	198	1	4
α-helix	199-201	3
α-helix	202-220	19
β-strand	222	1	5
β-strand	225-233	9	5
β-strand	239-244	6	5
α-helix	245-248	4
β-strand	255	1	3
α-helix	260-263	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ricin	A	protein	263	RICINUS COMMUNIS	P02879 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UQ5_1 RICIN (chains A)
QYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSN
HAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGAYD
RLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYI
EGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYD
VSILIPIIALMVYRCAPPPSSQF

Primary citation

The Effect of Mutations Surrounding and within the Active Site on the Catalytic Activity of Ricin a Chain. Marsden, C.J., Fulop, V., Day, P. et al. Eur J Biochem (2004) 271:153. DOI 10.1046/J.1432-1033.2003.03914.X · PubMed

Other PDB entries of the same protein (UniProt P02879 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Y07 1.25 Å, Crystal structure of Ricin A chain bound with (S)-2-amino-N-(1-hydroxy-3-phenylpropan-2-y…
7Y08 1.25 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
3PX8 1.29 Å, RTA in complex with 7-carboxy-pterin
7XZT 1.3 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7TGF 1.35 Å, Single-domain VHH intrabodies neutralize ricin toxin.
7Y03 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
7Y06 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
2VC4 1.39 Å, Ricin A-Chain (Recombinant) E177D Mutant
7XZW 1.45 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7Y4M 1.45 Å, Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-ca…
1J1M 1.5 Å, Ricin A-Chain (Recombinant) at 100K
4Z9K 1.5 Å, Ricin A chain bound to camelid nanobody (VHH2)(F5)

Browse structure collections

About this viewer

MolViewer shows 1UQ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.