1UT2: AfaE-3 adhesin from Escherichia Coli

Name: PDB 1UT2: AfaE-3 adhesin from Escherichia Coli
Published: 2004-08-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: adhesin

AfaE-3 adhesin from Escherichia Coli. Determined by X-ray diffraction at 3.3 Å resolution. Released 31 Aug 2004.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: ESCHERICHIA COLI
Chains: 9
Atoms: 9,539
Mol. weight: 145.97 kDa
Released: 31 Aug 2004

Explore 1UT2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UT2 contains 26 α-helices and 111 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	1
β-strand	20-23	4	2
β-strand	28-31	4	1
α-helix	32-34	3
β-strand	40-49	10	1
β-strand	55-60	6	1
α-helix	62-64	3
β-strand	65	1	1
β-strand	70-74	5	1
β-strand	80-87	8	1
β-strand	93-96	4	1
β-strand	99-102	4	1
β-strand	109-116	8	1
α-helix	123-124	2
β-strand	126-137	12	1

Chains B and E: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	3
β-strand	20-23	4	1
β-strand	28-31	4	3
α-helix	32-34	3
β-strand	40-49	10	3
β-strand	55-60	6	3
α-helix	62-64	3
β-strand	65	1	3
β-strand	70-74	5	3
β-strand	80-87	8	3
β-strand	93-96	4	3
β-strand	99-102	4	3
β-strand	106	1	3
β-strand	109-116	8	3
α-helix	123-124	2
β-strand	126-137	12	3

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	2
β-strand	20-22	3	3
β-strand	29-31	3	2
α-helix	32-34	3
β-strand	40-49	10	2
β-strand	55-60	6	2
α-helix	62-64	3
β-strand	65	1	2
β-strand	70-74	5	2
β-strand	80-87	8	2
β-strand	93-96	4	2
β-strand	99-102	4	2
β-strand	109-116	8	2
α-helix	123-124	2
β-strand	126-137	12	2

Chain D: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	4
β-strand	20-23	4	5
β-strand	29-31	3	4
α-helix	32-34	3
β-strand	40-49	10	4
β-strand	55-60	6	4
α-helix	62-64	3
β-strand	65	1	4
β-strand	70-74	5	4
β-strand	80-87	8	4
β-strand	93-96	4	4
β-strand	99-105	7	4
β-strand	109-116	8	4
α-helix	123-124	2
β-strand	126-137	12	4

Chain F: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	7
β-strand	20-23	4	8
β-strand	29-31	3	7
α-helix	32-34	3
β-strand	40-49	10	7
β-strand	55-60	6	7
α-helix	62-64	3
β-strand	65	1	7
β-strand	70-74	5	7
β-strand	80-87	8	7
β-strand	93-96	4	7
β-strand	99-102	4	7
β-strand	109-116	8	7
α-helix	123-124	2
β-strand	126-137	12	7

Chain G: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	8
β-strand	20-22	3	9
β-strand	28-31	4	8
α-helix	32-34	3
β-strand	40-49	10	8
β-strand	55-60	6	8
α-helix	62-64	3
β-strand	65	1	8
β-strand	70-74	5	8
β-strand	80-87	8	8
β-strand	93-96	4	8
β-strand	99-102	4	8
β-strand	106	1	8
β-strand	109-116	8	8
α-helix	123-124	2
β-strand	126-137	12	8

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	9
β-strand	20-23	4	7
β-strand	28-31	4	9
β-strand	40-49	10	9
β-strand	55-60	6	9
α-helix	62-64	3
β-strand	65	1	9
β-strand	70-74	5	9
β-strand	80-87	8	9
β-strand	93-96	4	9
β-strand	99-102	4	9
β-strand	109-116	8	9
α-helix	123-124	2
β-strand	126-137	12	9

Chain I: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-16	15	6
β-strand	20-23	4	4
β-strand	28-31	4	6
α-helix	32-34	3
β-strand	40-49	10	6
β-strand	55-60	6	6
α-helix	62-64	3
β-strand	65-66	2	6
β-strand	69-74	6	6
β-strand	80-87	8	6
β-strand	93-96	4	6
β-strand	99-102	4	6
β-strand	109-116	8	6
α-helix	123-124	2
β-strand	126-137	12	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afimbrial adhesin afa-III	A, B, C, D, E, F, G, H, I	protein	149	ESCHERICHIA COLI	Q57254 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>1UT2_1 AFIMBRIAL ADHESIN AFA-III (chains A, B, C, D, E, F, G, H, I)
RGSHHHHHHGSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALG
CNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGG
TIGIYVDGQQTNTPPGNYTLTLTGGYWAK

Primary citation

High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol. Pettigrew, D., Anderson, K.L., Billington, J. et al. J Biol Chem (2004) 279:46851. DOI 10.1074/JBC.M409284200 · PubMed

Other PDB entries of the same protein (UniProt Q57254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1USZ 3.28 Å, SeMet AfaE-3 adhesin from Escherichia Coli
1RXL Solution structure of the engineered protein Afae-dsc
2IXQ The solution structure of the invasive tip complex from Afa-Dr fibrils
2VER Structural model for the complex between the Dr adhesins and carcinoembryonic antigen…

Browse structure collections

About this viewer

MolViewer shows 1UT2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.