1UW4: UPF3X

The structural basis of the interaction between nonsense mediated decay factors UPF2 and UPF3. Determined by X-ray diffraction at 1.95 Å resolution. Released 11 Mar 2004.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 5,996
Mol. weight: 80.52 kDa
Released: 11 Mar 2004

Explore 1UW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UW4 contains 43 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	52-58	7	1
α-helix	64-71	8
α-helix	72	1
α-helix	74-76	3
β-strand	77-84	8	1
β-strand	95-101	7	1
α-helix	105-114	10
β-strand	118-120	3	2
β-strand	126-128	3	2
β-strand	130-133	4	1

Chain B: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	770-777	8
α-helix	778-782	5
α-helix	788-796	9
α-helix	803-814	12
α-helix	816-818	3
α-helix	821-823	3
α-helix	824-834	11
α-helix	839-859	21
α-helix	862-864	3
α-helix	865-880	16
α-helix	886-898	13
α-helix	917-929	13
α-helix	930-932	3
α-helix	936-957	22
α-helix	967-969	3
α-helix	970-983	14
α-helix	993-1011	19

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	52-58	7	3
α-helix	64-71	8
α-helix	72	1
α-helix	74-76	3
β-strand	77-83	7	3
β-strand	95-101	7	3
α-helix	104-114	11
β-strand	118-120	3	4
β-strand	126-128	3	4
β-strand	130-133	4	3

Chain D: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	770-777	8
α-helix	778-782	5
α-helix	785-787	3
α-helix	788-796	9
α-helix	803-814	12
α-helix	816-818	3
α-helix	821-823	3
α-helix	824-834	11
α-helix	839-859	21
α-helix	862-864	3
α-helix	865-880	16
α-helix	886-898	13
α-helix	917-929	13
α-helix	930-932	3
α-helix	936-957	22
α-helix	967-969	3
α-helix	970-983	14
α-helix	993-1011	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UPF3X	A, C	protein	91	HOMO SAPIENS	Q9BZI7 (AlphaFold model)
Regulator of nonsense transcripts 2	B, D	protein	248	HOMO SAPIENS	Q9HAU5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1UW4_1 UPF3X (chains A, C)
LSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIIL
FRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA

Sequence of entity 2 (B, D), FASTA

>1UW4_2 REGULATOR OF NONSENSE TRANSCRIPTS 2 (chains B, D)
RPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCV
ANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESA
VIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLV
YFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREF
LIKLGLVN

Primary citation

The Structural Basis for the Interaction between Nonsense-Mediated Mrna Decay Factors Upf2 and Upf3. Kadlec, J., Izaurralde, E., Cusack, S. Nat Struct Mol Biol (2004) 11:330. DOI 10.1038/NSMB741 · PubMed

Other PDB entries of the same protein (UniProt Q9BZI7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NWU 2.6 Å, Co-crystal structure of UPF3B-RRM-NOPS-L with UPF2-MIF4GIII
2XB2 3.4 Å, Crystal structure of the core Mago-Y14-eIF4AIII-Barentsz-UPF3b assembly shows how the…

Browse structure collections

About this viewer

MolViewer shows 1UW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.