AXH domain of the transcription factor HBP1 from M.musculus. Determined by solution NMR. Released 21 Apr 2005.
Explore 1V06 in 3D Show helices and sheets RCSB PDB PDBe
1V06 contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 212 | 1 | 1 |
| β-strand | 215 | 1 | 1 |
| β-strand | 220-223 | 4 | 2 |
| β-strand | 232-233 | 2 | 2 |
| α-helix | 234-240 | 7 | |
| β-strand | 262-272 | 11 | 2 |
| β-strand | 275-283 | 9 | 2 |
| α-helix | 287-289 | 3 | |
| β-strand | 292-296 | 5 | 2 |
| β-strand | 302-304 | 3 | 2 |
| β-strand | 308-311 | 4 | 2 |
| α-helix | 314-321 | 8 | |
| β-strand | 326-327 | 2 | 2 |
| α-helix | 328 | 1 | |
| α-helix | 332 | 1 | |
| β-strand | 333-334 | 2 | 2 |
| α-helix | 335-336 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hmg box-containing protein 1 | A | protein | 142 | MUS MUSCULUS | Q8R316 (AlphaFold model) |
>1V06_1 HMG BOX-CONTAINING PROTEIN 1 (chains A) GAMAPSTIWHCFLKGTRLCFHKESNKEWQDVEDFARAASCDNEEEIQMGTHKGYGSDGLK LLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGI PCCEIHIGDVCLPPGHPDAINF
The Axh Domain Adopts Alternative Folds the Solution Structure of Hbp1 Axh. De Chiara, C., Menon, R.P., Adinolfi, S. et al. Structure (2005) 13:743. DOI 10.1016/J.STR.2005.02.016 · PubMed
Other PDB entries of the same protein (UniProt Q8R316 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1V06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.