1V1G: Arabidopsis thaliana SOS3

Structure of the Arabidopsis thaliana SOS3 complexed with Calcium(II) ion. Determined by X-ray diffraction at 2.7 Å resolution. Released 19 Jan 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: ARABIDOPSIS THALIANA
Chains: 1
Atoms: 1,614
Mol. weight: 27.01 kDa
Ligands: CA
Released: 19 Jan 2005

Explore 1V1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1V1G contains 12 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	22-26	5
α-helix	33-46	14
β-strand	56	1	1
α-helix	58-66	9
α-helix	73-75	3
α-helix	76-83	8
β-strand	91	1	1
α-helix	93-101	9
α-helix	109-120	12
β-strand	128-129	2	2
α-helix	130-143	14
α-helix	150-164	15
β-strand	171-172	2	2
α-helix	174-183	10
α-helix	185-191	7
α-helix	194-197	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcineurin B-like protein 4	A	protein	222	ARABIDOPSIS THALIANA	O81223 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1V1G_1 CALCINEURIN B-LIKE PROTEIN 4 (chains A)
MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEE
FQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLY
DLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDF
VSLNPSLIKNMTLPYLKDINRTFPSFVSSCEEEEMELQNVSS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (MPD, IOD) are not listed.

Primary citation

The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response. Sanchez-Barrena, M.J., Martinez-Ripoll, M., Zhu, J.K. et al. J Mol Biol (2005) 345:1253. DOI 10.1016/J.JMB.2004.11.025 · PubMed

Other PDB entries of the same protein (UniProt O81223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O9U 1.85 Å, HsNMT1 in complex with CoA and Myristoylated-GCSVSKKK octapeptide
2EHB 2.1 Å, The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium…
1V1F 3.0 Å, Structure of the Arabidopsis thaliana SOS3 complexed with Calcium(II) and Manganese(II)…

Browse structure collections

About this viewer

MolViewer shows 1V1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.