1V9U: Human Rhinovirus 2

Human Rhinovirus 2 bound to a fragment of its cellular receptor protein. Determined by X-ray diffraction at 3.6 Å resolution. Released 4 May 2004.

Method: X-ray diffraction
Resolution: 3.6 Å
Organisms: Human rhinovirus 2, Homo sapiens
Chains: 5
Atoms: 6,451
Mol. weight: 100.17 kDa
Ligands: CA, DAO
Released: 4 May 2004

Explore 1V9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1V9U contains 27 α-helices and 63 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	20	1	2
α-helix	37-39	3
α-helix	47-50	4
β-strand	56	1	2
β-strand	61	1	1
α-helix	63-65	3
β-strand	66	1	3
α-helix	67-70	4
β-strand	75-83	9	4
β-strand	94-95	2	5
β-strand	98	1	5
α-helix	106-111	6
β-strand	114-131	18	4
β-strand	140-146	7	5
β-strand	148	1	6
β-strand	150	1	6
α-helix	151-153	3
α-helix	159-162	4
β-strand	167-172	6	5
β-strand	179-182	4	4
β-strand	191-192	2	4
β-strand	197	1	7
α-helix	207-209	3
β-strand	215-219	5	5
β-strand	229-247	19	4
α-helix	249-251	3
β-strand	257	1	8
α-helix	274-276	3
β-strand	277	1	9

Chain 2: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	10
β-strand	21-24	4	10
β-strand	32-33	2	11
α-helix	34-36	3
β-strand	54	1	11
α-helix	57-59	3
β-strand	64-65	2	11
β-strand	69-72	4	12
β-strand	78-80	3	13
α-helix	90-98	9
β-strand	99-111	13	11
β-strand	121-126	6	13
β-strand	134	1	14
α-helix	144-147	4
β-strand	154-155	2	13
α-helix	167	1
β-strand	168	1	14
α-helix	169	1
α-helix	172-174	3
α-helix	184-186	3
β-strand	189-192	4	13
β-strand	199-204	6	11
β-strand	213-214	2	11
β-strand	218	1	7
β-strand	223-229	7	13
β-strand	239-242	4	12
β-strand	243-256	14	11
α-helix	258-260	3

Chain 3: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	4
α-helix	31-33	3
β-strand	39-40	2	4
β-strand	42	1	3
α-helix	44-47	4
β-strand	51-52	2	15
β-strand	58	1	9
α-helix	65-67	3
β-strand	69-73	5	15
β-strand	81-83	3	16
β-strand	86	1	16
α-helix	94-96	3
α-helix	98-103	6
β-strand	106-110	5	17
β-strand	113-119	7	15
β-strand	126	1	18
β-strand	128	1	19
β-strand	129-134	6	16
α-helix	144-148	5
β-strand	151-153	3	16
β-strand	156	1	19
β-strand	164-167	4	15
β-strand	176-177	2	17
β-strand	187-192	6	16
β-strand	197	1	18
β-strand	205-214	10	15
β-strand	219-223	5	17
β-strand	236	1	8

Chain 4: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	20
β-strand	26-27	2	20

Chain 5: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	130-132	3
α-helix	144-146	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coat protein VP1	1	protein	289	Human rhinovirus 2	P04936 (AlphaFold model)
Coat protein VP2	2	protein	261	Human rhinovirus 2	P04936 (AlphaFold model)
Coat protein VP3	3	protein	237	Human rhinovirus 2	P04936 (AlphaFold model)
Coat protein VP4	4	protein	68	Human rhinovirus 2	P04936 (AlphaFold model)
LDL-receptor class A 3	5	protein	41	Homo sapiens	P98155 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>1V9U_1 Coat protein VP1 (chains 1)
NPVENYIDEVLNEVLVVPNINSSNPTTSNSAPALDAAETGHTSSVQPEDVIETRYVQTSQ
TRDEMSLESFLGRSGCIHESKLEVTLANYNKENFTVWAINLQEMAQIRRKFELFTYTRFD
SEITLVPCISALSQDIGHITMQYMYVPPGAPVPNSRDDYAWQSGTNASVFWQHGQAYPRF
SLPFLSVASAYYMFYDGYDEQDQNYGTANTNNMGSLCSRIVTEKHIHKVHIMTRIYHKAK
HVKAWCPRPPRALEYTRAHRTNFKIEDRSIQTAIVTRPIITTAGPSDMY

Sequence of entity 2 (2), FASTA

>1V9U_2 Coat protein VP2 (chains 2)
SPTVEACGYSDRIIQITRGDSTITSQDVANAIVAYGVWPHYLSSKDASAIDKPSQPDTSS
NRFYTLRSVTWSSSSKGWWWKLPDALKDMGIFGENMFYHYLGRSGYTIHVQCNASKFHQG
TLIVALIPEHQIASALHGNVNVGYNYTHPGETGREVKAETRLNPDLQPTEEYWLNFDGTL
LGNITIFPHQFINLRSNNSATIIAPYVNAVPMDSMRSHNNWSLVIIPICPLETSSAINTI
PITISISPMCAEFSGARAKRQ

Sequence of entity 3 (3), FASTA

>1V9U_3 Coat protein VP3 (chains 3)
GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDT
YINSENMYSVVLQSSINAPDKIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFC
GTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQSTISMVVPWISASHYRNTSP
GRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ

Sequence of entity 4 (4), FASTA

>1V9U_4 Coat protein VP4 (chains 4)
GAQVSRQNVGTHSTQNSVSNGSSLNYFNINYFKDAASNGASKLEFTQDPSKFTDPVKDVL
EKGIPTLQ

Sequence of entity 5 (5), FASTA

>1V9U_5 LDL-receptor class A 3 (chains 5)
RTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGN

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
DAO	Lauric acid	C12 H24 O2	1

Primary citation

X-ray structure of a minor group human rhinovirus bound to a fragment of its cellular receptor protein. Verdaguer, N., Fita, I., Reithmayer, M. et al. Nat Struct Mol Biol (2004) 11:429-434. DOI 10.1038/nsmb753 · PubMed

Other PDB entries of the same protein (UniProt P04936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FX6 1.45 Å, Novel inhibitors of human rhinovirus 3C protease
5FX5 1.7 Å, Novel inhibitors of human rhinovirus 3C protease
6FFN 1.75 Å, Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease…
9W3O 1.76 Å, Crystal Structure of Human rhinovirus A2 3C Protease in Complex with a Broad-spectrum…
1CQQ 1.85 Å, Type 2 rhinovirus 3C protease with AG7088 inhibitor
6FFS 1.86 Å, Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease…
2HRV 1.95 Å, 2A cysteine proteinase from human rhinovirus 2
1A3R 2.1 Å, FAB fragment (antibody 8F5) complexed with peptide from human rhinovirus (serotype 2)…
7ARA 2.24 Å, Rhinovirus A2 2A protease in complex with zVAM.fmk
2XYA 2.4 Å, Non-covalent inhibtors of rhinovirus 3C protease.
1FPN 2.6 Å, Human rhinovirus serotype 2 (HRV2)
3TN9 3.0 Å, X-ray structure of the HRV2 empty capsid (B-particle)

Browse structure collections

About this viewer

MolViewer shows 1V9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.