1VHI: Epstein barr virus nuclear antigen-1

Epstein barr virus nuclear antigen-1 DNA-binding domain, residues 470-607. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Dec 1996.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Human herpesvirus 4
Chains: 2
Atoms: 2,142
Mol. weight: 30.73 kDa
Released: 23 Dec 1996

Explore 1VHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VHI contains 11 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	477-490	14
β-strand	503-511	9	1
α-helix	514-527	14
β-strand	532-533	2	1
β-strand	537-540	4	1
α-helix	552-554	3
β-strand	556-566	11	1
α-helix	569-583	15
α-helix	590-592	3
β-strand	593-604	12	1

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	477-489	13
β-strand	505-511	7	1
α-helix	514-527	14
β-strand	532-533	2	1
α-helix	534-536	3
β-strand	537-540	4	1
α-helix	541	1
β-strand	556-566	11	1
α-helix	569-584	16
α-helix	590-592	3
β-strand	593-600	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epstein barr virus nuclear antigen-1	A, B	protein	142	Human herpesvirus 4	P03211 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1VHI_1 EPSTEIN BARR VIRUS NUCLEAR ANTIGEN-1 (chains A, B)
GSHMGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTA
LAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMT
KPAPTCNIRVTVCSFDDGVDLP

Primary citation

Crystal structure of the DNA-binding domain of the Epstein-Barr virus origin-binding protein EBNA 1. Bochkarev, A., Barwell, J.A., Pfuetzner, R.A. et al. Cell (1995) 83:39-46. DOI 10.1016/0092-8674(95)90232-5 · PubMed

Other PDB entries of the same protein (UniProt P03211 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VH6 1.3 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragment
6NPP 1.35 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
2FYY 1.5 Å, The role of T cell receptor alpha genes in directing human MHC restriction
6NPI 1.5 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
6NPM 1.6 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
4PRE 1.65 Å, Crystal structure of a HLA-B*35:08-HPVG-Q5
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
4PRA 1.85 Å, Crystal structure of a HLA-B*35:01-HPVG-Q5
2FZ3 1.9 Å, The role of T cell receptor alpha genes in directing human MHC restriction
5WMF 1.9 Å, Crystal structure of the Hexameric Ring of Epstein-Barr Virus Nuclear Antigen-1, EBNA1
3MV7 2.0 Å, Crystal Structure of the TK3 TCR in complex with HLA-B*3501/HPVG
5WUM 2.0 Å, Crystal structure of mouse importin-alpha1 bound to S385-phosphorylated NLS of EBNA1

Browse structure collections

About this viewer

MolViewer shows 1VHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.