1W6V: DUSP domain of hUSP15

Solution structure of the DUSP domain of hUSP15. Determined by solution NMR. Released 12 Jan 2006.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 977
Mol. weight: 16.15 kDa
Released: 12 Jan 2006

Explore 1W6V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1W6V contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
β-strand	29-34	6	1
α-helix	35-45	11
β-strand	65	1	2
β-strand	71	1	3
β-strand	79	1	3
β-strand	89-92	4	1
α-helix	94-103	10
β-strand	106	1	2
β-strand	114-116	3	1
α-helix	117-118	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 15	A	protein	141	HOMO SAPIENS	Q9Y4E8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1W6V_1 UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15 (chains A)
MGSSHHHHHHSSGLVPRGSHMMAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFK
QWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNK
LVSWYTLMEGQEPIARKVVEQ

Primary citation

Solution Structure of the Human Ubiquitin-Specific Protease 15 Dusp Domain. De Jong, R.N., Ab, E., Diercks, T. et al. J Biol Chem (2006) 281:5026. DOI 10.1074/JBC.M510993200 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4E8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4A3P 1.4 Å, Structure of USP15 DUSP-UBL deletion mutant
3T9L 1.5 Å, Structure of N-terminal DUSP-UBL domains of human USP15
6ML1 1.9 Å, Structure of the USP15 deubiquitinase domain in complex with an affinity-matured…
6GHA 1.98 Å, USP15 catalytic domain structure
7R2G 1.98 Å, USP15 D1D2 in catalytically-competent state bound to mitoxantrone stack (isoform 2)
6CPM 2.01 Å, Structure of the USP15 deubiquitinase domain in complex with a third-generation…
6GH9 2.09 Å, USP15 catalytic domain in complex with small molecule
3LMN 2.15 Å, Oligomeric structure of the DUSP domain of human USP15
4A3O 2.2 Å, Crystal structure of the USP15 DUSP-UBL monomer
9VVV 2.3 Å, Crystal structure of USP15 catalytic domain in complex with Ub-PA
3PPA 2.35 Å, Structure of the Dusp-Ubl domains of Usp15
6CRN 2.5 Å, Structure of the USP15 deubiquitinase domain in complex with a high-affinity…

Browse structure collections

About this viewer

MolViewer shows 1W6V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.