1W7Z: Trypsin inhibitor II

Crystal structure of the free (uncomplexed) Ecballium elaterium trypsin inhibitor (EETI-II). Determined by X-ray diffraction at 1.67 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: ECBALLIUM ELATERIUM
Chains: 8
Atoms: 1,887
Mol. weight: 25.36 kDa
Released: 1 Nov 2005

Explore 1W7Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1W7Z contains 15 α-helices and 44 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	7	1	2
β-strand	8	1	3
α-helix	12-14	3
α-helix	16	1
β-strand	20-21	2	4
β-strand	26	1	3
β-strand	27-28	2	4

Chain G: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	19
α-helix	12-14	3
β-strand	20-21	2	20
β-strand	26	1	19
β-strand	27-28	2	20

Chain H: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	21
α-helix	12-14	3
α-helix	16	1
β-strand	20-21	2	22
β-strand	26	1	21
β-strand	27-28	2	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin inhibitor II	A, B, C, D, E, F, G, H	protein	31	ECBALLIUM ELATERIUM	P12071 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1W7Z_1 TRYPSIN INHIBITOR II (chains A, B, C, D, E, F, G, H)
GCPRILIRCKQDSDCLAGCVCGPNGFCGSPA

Primary citation

Structure of Ecballium Elaterium Trypsin Inhibitor II (Eeti-II): A Rigid Molecular Scaffold. Kraetzner, R., Debreczeni, J.E., Pape, T. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:1255. DOI 10.1107/S0907444905021207 · PubMed

Other PDB entries of the same protein (UniProt P12071 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C4B 1.3 Å, Inhibitor cystine knot protein McoEeTI fused to the catalytically inactive barnase…
1H9H 1.5 Å, Complex of eeti-II with porcine trypsin
1H9I 1.9 Å, Complex of eeti-II mutant with porcine trypsin
6MSL 3.1 Å, Integrin AlphaVBeta3 ectodomain bound to EETI-II 2.5D
6MSU 3.11 Å, Integrin alphaVBeta3 in complex with EETI-II 2.5F
2ETI Use of restrained molecular dynamics in water to determine three-dimensional protein…
2IT7 Solution structure of the squash trypsin inhibitor EETI-II
2LET An 1H NMR determination of the three dimensional structures of mirror image forms of a…

Browse structure collections

About this viewer

MolViewer shows 1W7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.