1WBP: SRPK1

SRPK1 bound to 9mer docking motif peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Oct 2005.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,941
Mol. weight: 46.93 kDa
Ligands: ADP
Released: 19 Oct 2005

Explore 1WBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WBP contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	75-76	2	1
β-strand	80-88	9	1
β-strand	93-99	7	1
β-strand	104-110	7	1
α-helix	115-133	19
α-helix	139-143	5
β-strand	144	1	2
β-strand	147-154	8	1
β-strand	159-165	7	1
β-strand	168-171	4	2
α-helix	172-178	7
α-helix	186-202	17
α-helix	203-207	5
β-strand	209-210	2	3
α-helix	216-218	3
β-strand	219-222	4	2
α-helix	225-235	11
β-strand	493-495	3	2
β-strand	502-503	2	3
α-helix	515-517	3
α-helix	520-524	5
α-helix	531-546	16
α-helix	561-573	13
α-helix	578-583	6
α-helix	587-589	3
β-strand	591	1	4
β-strand	597	1	4
α-helix	608-614	7
α-helix	620-630	11
α-helix	631-634	4
α-helix	644-648	5
α-helix	651-654	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase SPRK1	A	protein	397	HOMO SAPIENS	Q96SB4 (AlphaFold model)
Membrane-associated guanylate kinase, ww and PDZ domain-containing protein 1	B	protein	9	HOMO SAPIENS	Q96QZ7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WBP_1 SERINE/THREONINE-PROTEIN KINASE SPRK1 (chains A)
PEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQ
GKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHI
CMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILL
SVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPATAGNFLVNPLEPKNAEKLKVKIADL
GNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEE
YTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEW
SQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS

Sequence of entity 2 (B), FASTA

>1WBP_2 MEMBRANE-ASSOCIATED GUANYLATE KINASE, WW AND PDZ DOMAIN-CONTAINING PROTEIN 1 (chains B)
RRRERSPTR

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Interplay between Srpk and Clk/Sty Kinases in Phosphorylation of the Splicing Factor Asf/Sf2 is Regulated by a Docking Motif in Asf/Sf2. Ngo, J.C., Chakrabarti, S., Ding, J.-H. et al. Mol Cell (2005) 20:77. DOI 10.1016/J.MOLCEL.2005.08.025 · PubMed

Other PDB entries of the same protein (UniProt Q96SB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NNG 1.2 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
5MY8 1.7 Å, Crystal structure of SRPK1 in complex with SPHINX31
1WAK 1.73 Å, X-ray structure of SRPK1
5MXX 1.75 Å, Crystal structure of human SR protein kinase 1 (SRPK1) in complex with compound 1
4WUA 2.0 Å, Crystal structure of human SRPK1 complexed to an inhibitor SRPIN340
7DD1 2.05 Å, Crystal structure of SRPK1 in complex with a peptide inhibitor
7PQS 2.2 Å, SRPK1 in complex with MSC2711186
7ZKS 2.28 Å, SRPK1 in complex with inhibitor
5XV7 2.32 Å, SRPK1 in complex with Alectinib
6FAD 2.8 Å, SR protein kinase 1 (SRPK1) in complex with the RGG-box of HSV1 ICP27
3BEG 2.9 Å, Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2

Browse structure collections

About this viewer

MolViewer shows 1WBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.