1WF2: RRM domain in HNRPC protein

Solution structure of RRM domain in HNRPC protein. Determined by solution NMR. Released 25 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 720
Mol. weight: 10.29 kDa
Released: 25 Nov 2004

Explore 1WF2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WF2 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	1
α-helix	30-35	6
β-strand	43-49	7	1
β-strand	51-57	7	1
α-helix	60-68	9
β-strand	74-75	2	2
β-strand	78-79	2	2
β-strand	81-84	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoproteins C1/C2	A	protein	98	Homo sapiens	P07910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WF2_1 Heterogeneous nuclear ribonucleoproteins C1/C2 (chains A)
GSSGSSGKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRSGPSSG

Primary citation

Solution structure of RRM domain in HNRPC protein. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P07910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LN4 1.3 Å, Crystal structure of HLA-B*4103 in complex with a 16mer self-peptide derived from…
1TXP Heterogeneous Nuclear Ribonucleoprotein (hnRNP) C Oligomerization Domain Tetramer
2MXY Solution structure of hnRNP C RRM in complex with 5'-AUUUUUC-3' RNA
2MZ1 Solution structure of hnRNP C RRM in complex with 5'-UUUUC-3' RNA

Browse structure collections

About this viewer

MolViewer shows 1WF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.