1WG7: Dedicator of cytokinesis protein 9

Solution structure of pleckstrin homology domain from human KIAA1058 protein. Determined by solution NMR. Released 27 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,170
Mol. weight: 16.71 kDa
Released: 27 Nov 2004

Explore 1WG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WG7 contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	21-26	6	2
α-helix	33-37	5
β-strand	41-49	9	2
β-strand	55-60	6	2
β-strand	71-73	3	2
β-strand	80-81	2	3
β-strand	91-95	5	3
β-strand	101-105	5	3
α-helix	109-134	26
β-strand	140	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dedicator of cytokinesis protein 9	A	protein	150	Homo sapiens	Q9BZ29 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WG7_1 Dedicator of cytokinesis protein 9 (chains A)
GSSGSSGAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFY
KDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILN
KILQLNFEAAMQEKRNGDSHEDDESGPSSG

Primary citation

Solution structure of pleckstrin homology domain from human KIAA1058 protein. Suetake, T., Inoue, K., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BZ29 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WM9 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
2WMO 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
2WMN 2.39 Å, Structure of the complex between DOCK9 and Cdc42-GDP.

Browse structure collections

About this viewer

MolViewer shows 1WG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.