Solution structure of pleckstrin homology domain from human KIAA1058 protein. Determined by solution NMR. Released 27 Nov 2004.
Explore 1WG7 in 3D Show helices and sheets RCSB PDB PDBe
1WG7 contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13 | 1 | 1 |
| β-strand | 21-26 | 6 | 2 |
| α-helix | 33-37 | 5 | |
| β-strand | 41-49 | 9 | 2 |
| β-strand | 55-60 | 6 | 2 |
| β-strand | 71-73 | 3 | 2 |
| β-strand | 80-81 | 2 | 3 |
| β-strand | 91-95 | 5 | 3 |
| β-strand | 101-105 | 5 | 3 |
| α-helix | 109-134 | 26 | |
| β-strand | 140 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dedicator of cytokinesis protein 9 | A | protein | 150 | Homo sapiens | Q9BZ29 (AlphaFold model) |
>1WG7_1 Dedicator of cytokinesis protein 9 (chains A) GSSGSSGAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFY KDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILN KILQLNFEAAMQEKRNGDSHEDDESGPSSG
Solution structure of pleckstrin homology domain from human KIAA1058 protein. Suetake, T., Inoue, K., Hayashi, F. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BZ29 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.