Allergen phl P 2. Determined by X-ray diffraction at 3.0 Å resolution. Released 7 Jul 1997.
Explore 1WHP in 3D Show helices and sheets RCSB PDB PDBe
1WHP contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-8 | 5 | 1 |
| β-strand | 13 | 1 | 1 |
| β-strand | 16-23 | 8 | 1 |
| β-strand | 28-34 | 7 | 2 |
| β-strand | 42-43 | 2 | 2 |
| β-strand | 45-46 | 2 | 1 |
| β-strand | 51-55 | 5 | 1 |
| β-strand | 64-70 | 7 | 2 |
| β-strand | 75-82 | 8 | 2 |
| β-strand | 91-92 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Allergen phl P 2 | A | protein | 96 | Phleum pratense | P43214 (AlphaFold model) |
>1WHP_1 ALLERGEN PHL P 2 (chains A) VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Crystal Structure of Phl P 2, a Major Timothy Grass (Phleum Pratense) Pollen Allergen. Fedorov, A.A., Fedorov, E.V., Dolecek, C. et al. To be published.
Other PDB entries of the same protein (UniProt P43214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WHP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.