1WJO: Forth CH domain from human plastin 3 T-isoform

Solution structure of the forth CH domain from human plastin 3 T-isoform. Determined by solution NMR. Released 29 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 923
Mol. weight: 13.26 kDa
Released: 29 Nov 2004

Explore 1WJO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WJO contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	10-23	14
α-helix	37-39	3
α-helix	41-50	10
α-helix	67-83	17
α-helix	92-97	6
α-helix	105-113	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-plastin	A	protein	124	Homo sapiens	P13797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WJO_1 T-plastin (chains A)
GSSGSSGNDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLV
KSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRVSG
PSSG

Primary citation

Solution structure of the forth CH domain from human plastin 3 T-isoform. Tomizawa, T., Kigawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P13797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AOA 2.4 Å, N-terminal actin-crosslinking domain from human fimbrin
7R94 2.6 Å, T-Plastin-F-actin complex
7SXA 6.87 Å, T-Plastin-F-actin complex, pre-bundling intermediate state
7SX8 9.0 Å, T-Plastin-F-actin complex, parallel bundled state
7SX9 10.0 Å, T-Plastin-F-actin complex, anti-parallel bundled state

Browse structure collections

About this viewer

MolViewer shows 1WJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.