1WLX: Third spectrin repeat of alpha-actinin-4

Solution structure of the third spectrin repeat of alpha-actinin-4. Determined by solution NMR. Released 9 Aug 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,043
Mol. weight: 14.84 kDa
Released: 9 Aug 2005

Explore 1WLX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WLX contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-36	34
α-helix	38-39	2
α-helix	44-84	41
α-helix	100-125	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin 4	A	protein	129	Homo sapiens	O43707 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WLX_1 Alpha-actinin 4 (chains A)
GSTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKST
LPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHA
LLEEQSKQQ

Primary citation

Solution structure of the third spectrin repeat of alpha-actinin-4. Kowalski, K., Merkel, A.L., Booker, G.W. To be published.

Other PDB entries of the same protein (UniProt O43707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OA6 1.37 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4
6O31 1.51 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
2R0O 2.2 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(K255E)

Browse structure collections

About this viewer

MolViewer shows 1WLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.