1WSX: MCL-1

Solution structure of MCL-1. Determined by solution NMR. Released 23 Nov 2004.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,288
Mol. weight: 18.26 kDa
Released: 23 Nov 2004

Explore 1WSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WSX contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	154-172	19
α-helix	175-176	2
α-helix	185-215	31
α-helix	224-234	11
α-helix	242-261	20
α-helix	265-282	18
α-helix	284-289	6
α-helix	293-299	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
myeloid cell leukemia sequence 1	A	protein	162	Mus musculus	P97287 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WSX_1 myeloid cell leukemia sequence 1 (chains A)
GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQES
FIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG

Primary citation

Solution Structure of Prosurvival Mcl-1 and Characterization of Its Binding by Proapoptotic BH3-only Ligands. Day, C.L., Chen, L., Richardson, S.J. et al. J Biol Chem (2005) 280:4738-4744. DOI 10.1074/jbc.M411434200 · PubMed

Other PDB entries of the same protein (UniProt P97287 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NL9 1.55 Å, Crystal structure of the Mcl-1:Bim BH3 complex
4BPJ 1.6 Å, Mcl-1 bound to alpha beta Puma BH3 peptide 3
5VX2 1.85 Å, Mcl-1 in complex with Bim-h3Pc-RT
4BPI 1.98 Å, Mcl-1 bound to alpha beta Puma BH3 peptide 2
4G35 2.0 Å, Mcl-1 in complex with a biphenyl cross-linked Noxa peptide.
3D7V 2.03 Å, Crystal structure of Mcl-1 in complex with an Mcl-1 selective BH3 ligand
5KU9 2.2 Å, Crystal structure of MCL1 with compound 1
5MES 2.24 Å, MCL1 FAB complex in complex with compound 29
3IO9 2.4 Å, BimL12Y in complex with Mcl-1
6DM8 2.7 Å, Understanding the Species Selectivity of Myeloid cell leukemia-1 (Mcl-1) inhibitors
2NLA 2.8 Å, Crystal structure of the Mcl-1:mNoxaB BH3 complex
5MEV 2.94 Å, MCL1 FAB complex in complex with compound 21

Browse structure collections

About this viewer

MolViewer shows 1WSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.