Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase. Determined by solution NMR. Released 26 Jul 2005.
Explore 1WXM in 3D Show helices and sheets RCSB PDB PDBe
1WXM contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| β-strand | 19-23 | 5 | 1 |
| β-strand | 29 | 1 | 2 |
| α-helix | 31-39 | 9 | |
| β-strand | 48-53 | 6 | 1 |
| β-strand | 58-61 | 4 | 1 |
| β-strand | 66 | 1 | 2 |
| β-strand | 74-79 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| A-Raf proto-oncogene serine/threonine-protein kinase | A | protein | 86 | Homo sapiens | P10398 (AlphaFold model) |
>1WXM_1 A-Raf proto-oncogene serine/threonine-protein kinase (chains A) GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTV TAWDTAIAPLDGEELIVEVLSGPSSG
Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase. Zhao, C., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt P10398 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.