1WXM: PDB entry 1WXM

Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase. Determined by solution NMR. Released 26 Jul 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 637
Mol. weight: 9.13 kDa
Released: 26 Jul 2005

Explore 1WXM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WXM contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	19-23	5	1
β-strand	29	1	2
α-helix	31-39	9
β-strand	48-53	6	1
β-strand	58-61	4	1
β-strand	66	1	2
β-strand	74-79	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
A-Raf proto-oncogene serine/threonine-protein kinase	A	protein	86	Homo sapiens	P10398 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WXM_1 A-Raf proto-oncogene serine/threonine-protein kinase (chains A)
GSSGSSGGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTV
TAWDTAIAPLDGEELIVEVLSGPSSG

Primary citation

Solution Structure of the N-terminal Ras-binding Domain (RBD) in Human a-Raf Kinase. Zhao, C., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P10398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSL 1.42 Å, Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214)
8VSM 1.5 Å, Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378)
8VSN 1.91 Å, Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379)
9AXM 2.42 Å, Crystal structure of ARAF/MEK1 complex with NST-628 and a RAF dimer
9ZDQ 2.51 Å, Cryo-EM structure of ARAF-MEK1 complex with GDC-0879 and a covalent MEK inhibitor…
2MSE NMR data-driven model of GTPase KRas-GNP:ARafRBD complex tethered to a lipid-bilayer…

Browse structure collections

About this viewer

MolViewer shows 1WXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.