1WXP: Death domain of nuclear matrix protein p84

Solution structure of the death domain of nuclear matrix protein p84. Determined by solution NMR. Released 28 Jul 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 838
Mol. weight: 12 kDa
Released: 28 Jul 2005

Explore 1WXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WXP contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	18-28	11
α-helix	32-35	4
α-helix	43-52	10
α-helix	56-71	16
α-helix	72-74	3
α-helix	77-86	10
α-helix	90-97	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
THO complex subunit 1	A	protein	110	Homo sapiens	Q96FV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WXP_1 THO complex subunit 1 (chains A)
GSSGSSGPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRA
KQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNSSGPSSG

Primary citation

Solution structure of the death domain of nuclear matrix protein p84. Niraula, T.N., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q96FV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7APK 3.3 Å, Structure of the human THO - UAP56 complex
7ZNL 3.45 Å, Structure of the human TREX core THO-UAP56 complex
7ZNK 3.9 Å, Structure of an endogenous human TREX complex bound to mRNA
8R7L 4.12 Å, Cryo-EM structure of the human TREX complex

Browse structure collections

About this viewer

MolViewer shows 1WXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.