1WYO: PDB entry 1WYO

Solution structure of the CH domain of human microtubule-associated protein RP/EB family member 3. Determined by solution NMR. Released 15 Aug 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,260
Mol. weight: 17.91 kDa
Released: 15 Aug 2005

Explore 1WYO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WYO contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	24-34	11
α-helix	42-47	6
α-helix	49-58	10
α-helix	76-92	17
α-helix	100-103	4
α-helix	109-123	15
α-helix	135-137	3
α-helix	144-146	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 3	A	protein	159	Homo sapiens	Q9UPY8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WYO_1 Microtubule-associated protein RP/EB family member 3 (chains A)
GSSGSSGMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFP
GCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKK
FFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFSGPSSG

Primary citation

Solution structure of the CH domain of human microtubule-associated protein RP/EB family member 3. Tomizawa, T., Kigawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UPY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CO1 1.4 Å, Crystal structure of microtubule binding domain of human EB3
3TQ7 2.3 Å, EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
3JAK 3.3 Å, Cryo-EM structure of GTPgammaS-microtubule co-polymerized with EB3 (merged dataset with…
3JAR 3.4 Å, Cryo-EM structure of GDP-microtubule co-polymerized with EB3
3JAL 3.5 Å, Cryo-EM structure of GMPCPP-microtubule co-polymerized with EB3
7SJ9 3.8 Å, 13pf E254A microtubule from recombinant human tubulin decorated with EB3
9F3S 4.2 Å, 13pf mosaic 20%E254Q - 80% E254N microtubule from recombinant human tubulin decorated…
9F3R 4.3 Å, 13pf E254Q microtubule from recombinant human tubulin decorated with EB3

Browse structure collections

About this viewer

MolViewer shows 1WYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.