1X3H: LIM domain of human Leupaxin

Solution structure of the LIM domain of human Leupaxin. Determined by solution NMR. Released 9 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 609
Mol. weight: 8.83 kDa
Ligands: ZN
Released: 9 Nov 2005

Explore 1X3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X3H contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	24	1	1
β-strand	30-32	3	2
β-strand	35-37	3	2
β-strand	43	1	3
β-strand	50	1	3
β-strand	57-58	2	4
β-strand	63-64	2	4
α-helix	66-73	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leupaxin	A	protein	80	Homo sapiens	O60711 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X3H_1 Leupaxin (chains A)
GSSGSSGKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELD
GRPFCELHYHHRRGSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of the LIM domain of human Leupaxin. Yoneyama, M., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt O60711 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
4XEF 2.5 Å, Pyk2-FAT complexed with Leupaxin LD motif LD1

Browse structure collections

About this viewer

MolViewer shows 1X3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.