Structure of a peptide:N-glycanase-Rad23 complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 Jun 2005.
Explore 1X3W in 3D Show helices and sheets RCSB PDB PDBe
1X3W contains 20 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-30 | 19 | |
| α-helix | 36-48 | 13 | |
| α-helix | 50-62 | 13 | |
| α-helix | 69-78 | 10 | |
| α-helix | 81-94 | 14 | |
| α-helix | 103-115 | 13 | |
| α-helix | 116-120 | 5 | |
| β-strand | 122-123 | 2 | 1 |
| α-helix | 127-129 | 3 | |
| β-strand | 140-146 | 7 | 2 |
| β-strand | 157-165 | 9 | 2 |
| β-strand | 171-177 | 7 | 2 |
| α-helix | 182-184 | 3 | |
| β-strand | 188-189 | 2 | 1 |
| α-helix | 191-203 | 13 | |
| β-strand | 208-214 | 7 | 3 |
| β-strand | 218-225 | 8 | 3 |
| β-strand | 230-234 | 5 | 3 |
| β-strand | 235 | 1 | 4 |
| β-strand | 240 | 1 | 4 |
| α-helix | 246 | 1 | |
| α-helix | 247-251 | 5 | |
| β-strand | 255 | 1 | 5 |
| β-strand | 258-262 | 5 | 3 |
| β-strand | 265-268 | 4 | 3 |
| α-helix | 270-273 | 4 | |
| β-strand | 278 | 1 | 5 |
| α-helix | 286-301 | 16 | |
| α-helix | 308-323 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 259-271 | 13 | |
| α-helix | 273-275 | 3 | |
| α-helix | 276-285 | 10 | |
| α-helix | 288-296 | 9 | |
| α-helix | 298-307 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| peptide:N-glycanase | A | protein | 335 | Saccharomyces cerevisiae | Q02890 (AlphaFold model) |
| UV excision repair protein RAD23 | B | protein | 72 | Saccharomyces cerevisiae | P32628 (AlphaFold model) |
>1X3W_1 peptide:N-glycanase (chains A) NNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYD NPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKP DCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETR KGRCGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIY SINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDD EIYQLACRDEQEQIELIRGKTQETKSESVSAASKS
>1X3W_2 UV excision repair protein RAD23 (chains B) GTTGGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMAN PEVFVSMLLEAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins. Lee, J.H., Choi, J.M., Lee, C. et al. Proc Natl Acad Sci U S A (2005) 102:9144-9149. DOI 10.1073/pnas.0502082102 · PubMed
Other PDB entries of the same protein (UniProt Q02890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.