1XED: Polymeric-immunoglobulin receptor

Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR. Determined by X-ray diffraction at 1.9 Å resolution. Released 23 Nov 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,148
Mol. weight: 77.8 kDa
Ligands: MG
Released: 23 Nov 2004

Explore 1XED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XED contains 18 α-helices and 61 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-13	5	2
β-strand	18-23	6	1
α-helix	28-32	5
β-strand	35-39	5	2
β-strand	47-51	5	2
β-strand	56	1	2
β-strand	64-69	6	1
β-strand	74-79	6	1
α-helix	84-86	3
β-strand	88-94	7	2
α-helix	97-99	3
β-strand	102-110	9	2

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	3
β-strand	9-13	5	4
β-strand	18-23	6	3
α-helix	28-32	5
β-strand	35-39	5	4
β-strand	47-51	5	4
β-strand	56	1	4
β-strand	64-69	6	3
α-helix	70-72	3
β-strand	74-79	6	3
α-helix	84-86	3
β-strand	88-94	7	4
β-strand	102-110	9	4
α-helix	111-112	2

Chain C: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	5
β-strand	9-13	5	6
β-strand	18-23	6	5
α-helix	30-32	3
β-strand	35-39	5	6
β-strand	47-51	5	6
β-strand	56	1	6
β-strand	64-69	6	5
α-helix	70-72	3
β-strand	74-79	6	5
α-helix	84-86	3
β-strand	88-94	7	6
β-strand	102-110	9	6

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	7
β-strand	9-13	5	8
β-strand	18-23	6	7
α-helix	28-32	5
β-strand	35-39	5	8
β-strand	47-51	5	8
β-strand	56	1	8
β-strand	64-69	6	7
α-helix	70-72	3
β-strand	74-79	6	7
α-helix	84-86	3
β-strand	88-94	7	8
β-strand	102-110	9	8

Chain E: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	9
β-strand	9-13	5	10
β-strand	18-23	6	9
β-strand	27	1	2
α-helix	28-32	5
β-strand	35-40	6	10
β-strand	46-51	6	10
β-strand	56	1	10
β-strand	64-69	6	9
β-strand	74-79	6	9
α-helix	84-86	3
β-strand	88-94	7	10
α-helix	97-99	3
β-strand	102-110	9	10

Chain F: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	11
β-strand	9-13	5	12
β-strand	18-23	6	11
α-helix	28-32	5
β-strand	35-40	6	12
β-strand	46-51	6	12
β-strand	56	1	12
β-strand	64-69	6	11
β-strand	74-79	6	11
α-helix	84-86	3
β-strand	88-94	7	12
β-strand	102-110	9	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymeric-immunoglobulin receptor	A, B, C, D, E, F	protein	117	Homo sapiens	P01833 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1XED_1 Polymeric-immunoglobulin receptor (chains A, B, C, D, E, F)
KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKY
AGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Crystal Structure of a Polymeric Immunoglobulin Binding Fragment of the Human Polymeric Immunoglobulin Receptor. Hamburger, A.E., West Jr., A.P., Bjorkman, P.J. Structure (2004) 12:1925-1935. DOI 10.1016/j.str.2004.09.006 · PubMed

Other PDB entries of the same protein (UniProt P01833 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D4K 2.6 Å, Crystal structure of the human polymeric Ig receptor (pIgR) ectodomain
6UE7 2.9 Å, Structure of dimeric sIgA complex
6UE9 2.9 Å, Structure of tetrameric sIgA complex (Class 2)
6UE8 3.0 Å, Structure of tetrameric sIgA complex (Class 1)
6UEA 3.0 Å, Structure of pentameric sIgA complex
8SKV 3.1 Å, Structure of human SIgA1 in complex with Streptococcus pyogenes protein M4 (Arp4)
6LX3 3.15 Å, Cryo-EM structure of human secretory immunoglobulin A
7YSG 3.18 Å, Cryo-EM structure of human FcmR bound to sIgM
8SKU 3.2 Å, Structure of human SIgA1 in complex with human CD89 (FcaR1)
6LXW 3.27 Å, Cryo-EM structure of human secretory immunoglobulin A in complex with the N-terminal…
7K0C 3.3 Å, Structure of Secretory IgM Core
6KXS 3.4 Å, Cryo-EM structure of human IgM-Fc in complex with the J chain and the ectodomain of pIgR

Browse structure collections

About this viewer

MolViewer shows 1XED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.