Crystal Structure of Internalin C from Listeria monocytogenes. Determined by X-ray diffraction at 2.05 Å resolution. Released 30 Aug 2005.
Explore 1XEU in 3D Show helices and sheets RCSB PDB PDBe
1XEU contains 11 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 41-42 | 2 | 1 |
| α-helix | 43-46 | 4 | |
| α-helix | 50-60 | 11 | |
| β-strand | 68-69 | 2 | 1 |
| α-helix | 71-74 | 4 | |
| β-strand | 79-81 | 3 | 2 |
| α-helix | 93-95 | 3 | |
| β-strand | 101-103 | 3 | 2 |
| α-helix | 113-115 | 3 | |
| β-strand | 123-125 | 3 | 2 |
| β-strand | 144-146 | 3 | 2 |
| β-strand | 154 | 1 | 3 |
| α-helix | 156-158 | 3 | |
| β-strand | 166-168 | 3 | 2 |
| β-strand | 176 | 1 | 3 |
| α-helix | 178-182 | 5 | |
| β-strand | 188-190 | 3 | 2 |
| β-strand | 198 | 1 | 4 |
| β-strand | 210-212 | 3 | 2 |
| β-strand | 213-219 | 7 | 5 |
| α-helix | 220-222 | 3 | |
| β-strand | 223-224 | 2 | 6 |
| β-strand | 228-232 | 5 | 7 |
| β-strand | 236 | 1 | 4 |
| α-helix | 241 | 1 | |
| β-strand | 242 | 1 | 4 |
| α-helix | 243-245 | 3 | |
| β-strand | 247-248 | 2 | 5 |
| α-helix | 249-251 | 3 | |
| β-strand | 253-255 | 3 | 7 |
| β-strand | 258-262 | 5 | 7 |
| β-strand | 269-280 | 12 | 5 |
| β-strand | 283-294 | 12 | 5 |
| β-strand | 295-296 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| internalin C | A | protein | 263 | Listeria monocytogenes | P71451 (AlphaFold model) |
>1XEU_1 internalin C (chains A) ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQ FFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRD TDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLT GQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKF SEYINVGETEAIFDGTVTQPIKN
Structure of internalin C from Listeria monocytogenes. Ooi, A., Hussain, S., Seyedarabi, A. et al. Acta Crystallogr D Biol Crystallogr (2006) 62:1287-1293. DOI 10.1107/S0907444906026746 · PubMed
Other PDB entries of the same protein (UniProt P71451 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XEU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.