1XM9: Armadillo repeat domain of plakophilin 1

Structure of the armadillo repeat domain of plakophilin 1. Determined by X-ray diffraction at 2.8 Å resolution. Released 22 Mar 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,237
Mol. weight: 50.49 kDa
Released: 22 Mar 2005

Explore 1XM9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XM9 contains 31 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	247-255	9
α-helix	260-272	13
α-helix	279-285	7
α-helix	288-295	8
α-helix	301-315	15
α-helix	319-327	9
α-helix	331-338	8
α-helix	344-358	15
α-helix	364-374	11
α-helix	375-380	6
α-helix	381-384	4
α-helix	400-413	14
α-helix	417-423	7
α-helix	429-443	15
α-helix	451-461	11
α-helix	465-468	4
α-helix	472-478	7
α-helix	518-523	6
α-helix	525-537	13
α-helix	541-554	14
α-helix	561-567	7
α-helix	568-572	5
α-helix	576-582	7
α-helix	588-602	15
α-helix	605-607	3
α-helix	608-614	7
α-helix	616-621	6
α-helix	633-648	16
α-helix	653-658	6
α-helix	661-672	12
α-helix	677-688	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
plakophilin 1	A	protein	457	Homo sapiens	Q13835 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XM9_1 plakophilin 1 (chains A)
GLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNV
QQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDEL
KEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTM
RNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNA
YTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDAT
LEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSR
HPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSM
LNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVL

Primary citation

Structure of the armadillo repeat domain of plakophilin 1. Choi, H.J., Weis, W.I. J Mol Biol (2005) 346:367-376. DOI 10.1016/j.jmb.2004.11.048 · PubMed

Other PDB entries of the same protein (UniProt Q13835 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9A8U Integrative structure of the epithelial desmosomal outer plaque

Browse structure collections

About this viewer

MolViewer shows 1XM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.