Crystal structure of S-adenosylmethionine synthetase. Determined by X-ray diffraction at 3.0 Å resolution. Released 8 Mar 1996.
Explore 1XRC in 3D Show helices and sheets RCSB PDB PDBe
1XRC contains 16 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-10 | 8 | 1 |
| α-helix | 15-33 | 19 | |
| β-strand | 38-46 | 9 | 2 |
| β-strand | 49-57 | 9 | 2 |
| α-helix | 64-75 | 12 | |
| β-strand | 78-79 | 2 | 3 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-85 | 2 | 3 |
| β-strand | 90-98 | 9 | 2 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-116 | 3 | |
| β-strand | 120-127 | 8 | 4 |
| α-helix | 136-153 | 18 | |
| β-strand | 160-173 | 14 | 1 |
| β-strand | 176-189 | 14 | 1 |
| α-helix | 195-202 | 8 | |
| α-helix | 203-207 | 5 | |
| α-helix | 213-215 | 3 | |
| β-strand | 221-224 | 4 | 1 |
| β-strand | 240-241 | 2 | 2 |
| α-helix | 246-249 | 4 | |
| β-strand | 265 | 1 | 2 |
| α-helix | 270-287 | 18 | |
| β-strand | 293-300 | 8 | 4 |
| β-strand | 309-313 | 5 | 4 |
| α-helix | 322-332 | 11 | |
| α-helix | 337-343 | 7 | |
| α-helix | 352-355 | 4 | |
| α-helix | 366-368 | 3 | |
| α-helix | 373-377 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S-adenosylmethionine synthetase | A | protein | 383 | Escherichia coli | P0A817 (AlphaFold model) |
>1XRC_1 S-ADENOSYLMETHIONINE SYNTHETASE (chains A) AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSA WVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQG LMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGI DAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCG LTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSY AIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHF GREHFPWEKTDKAQLLRDAAGLK
Water and common crystallization additives (K) are not listed.
Crystal structure of S-adenosylmethionine synthetase. Takusagawa, F., Kamitori, S., Misaki, S. et al. J Biol Chem (1996) 271:136-147. DOI 10.1074/jbc.271.1.136 · PubMed
Other PDB entries of the same protein (UniProt P0A817 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.