Crystal structure of NEUROTOXIN BONT/A complexed with Synaptosomal-associated protein 25. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Dec 2004.
Explore 1XTG in 3D Show helices and sheets RCSB PDB PDBe
1XTG contains 24 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-14 | 2 | |
| β-strand | 19-23 | 5 | 1 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 42-48 | 7 | 1 |
| α-helix | 54-56 | 3 | |
| α-helix | 61-62 | 2 | |
| α-helix | 81-99 | 19 | |
| α-helix | 102-113 | 12 | |
| α-helix | 115-117 | 3 | |
| β-strand | 119 | 1 | 2 |
| β-strand | 126-127 | 2 | 3 |
| β-strand | 128 | 1 | 2 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-138 | 5 | 1 |
| β-strand | 144-148 | 5 | 1 |
| β-strand | 151-155 | 5 | 1 |
| β-strand | 164-169 | 6 | 1 |
| α-helix | 170 | 1 | |
| α-helix | 175-177 | 3 | |
| β-strand | 184-187 | 4 | 1 |
| β-strand | 192-196 | 5 | 4 |
| α-helix | 198-200 | 3 | |
| β-strand | 213-214 | 2 | 4 |
| α-helix | 215-216 | 2 | |
| α-helix | 217-232 | 16 | |
| α-helix | 236-238 | 3 | |
| β-strand | 242-246 | 5 | 5 |
| β-strand | 250 | 1 | 6 |
| β-strand | 255-259 | 5 | 5 |
| α-helix | 260-266 | 7 | |
| α-helix | 268-271 | 4 | |
| α-helix | 276-299 | 24 | |
| β-strand | 302-303 | 2 | 3 |
| β-strand | 306 | 1 | 7 |
| α-helix | 310-320 | 11 | |
| β-strand | 324-325 | 2 | 8 |
| β-strand | 331-332 | 2 | 8 |
| α-helix | 335-343 | 9 | |
| α-helix | 344-348 | 5 | |
| α-helix | 351-358 | 8 | |
| β-strand | 372-375 | 4 | 4 |
| β-strand | 385 | 1 | 9 |
| β-strand | 389 | 1 | 9 |
| α-helix | 396-398 | 3 | |
| α-helix | 402-404 | 3 | |
| β-strand | 405 | 1 | 4 |
| α-helix | 410-412 | 3 | |
| β-strand | 414-415 | 2 | 4 |
| β-strand | 424 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 148-167 | 20 | |
| β-strand | 178 | 1 | 7 |
| β-strand | 191-193 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurotoxin bont/a | A | protein | 424 | Clostridium botulinum | P0DPI1 (AlphaFold model) |
| Synaptosomal-associated protein 25 | B | protein | 59 | Homo sapiens | P60880 (AlphaFold model) |
>1XTG_1 NEUROTOXIN BONT/A (chains A) PFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNP PPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGS TIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYG STQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHQLIHAGHRLYGIAINPNR VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAK SIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVL NRKTFLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTP LVPR
>1XTG_2 Synaptosomal-associated protein 25 (chains B) MDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (CL) are not listed.
Substrate recognition strategy for botulinum neurotoxin serotype A. Breidenbach, M.A., Brunger, A.T. Nature (2004) 432:925-929. DOI 10.1038/nature03123 · PubMed
Other PDB entries of the same protein (UniProt P0DPI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.