1XZ9: AF-6 PDZ domain

Structure of AF-6 PDZ domain. Determined by solution NMR. Released 15 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 726
Mol. weight: 10.39 kDa
Released: 15 Nov 2005

Explore 1XZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XZ9 contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
β-strand	22	1	2
β-strand	25-28	4	3
α-helix	38-40	3
β-strand	41-45	5	3
β-strand	49	1	2
α-helix	50-53	4
β-strand	62-66	5	1
β-strand	69-70	2	1
α-helix	76-84	9
β-strand	90-95	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afadin	A	protein	101	Homo sapiens	P55196 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XZ9_1 Afadin (chains A)
GPLGSLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAG
DQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIY

Primary citation

Discovery of low-molecular-weight ligands for the AF6 PDZ domain. Joshi, M., Vargas, C., Boisguerin, P. et al. Angew Chem Int Ed Engl (2006) 45:3790-3795. DOI 10.1002/anie.200503965 · PubMed

Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QCR 2.28 Å, MLLT4/Afadin PDZ domain in complex with the C-terminal peptide from protein E of…
5A6C 2.9 Å, Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation
1T2M Solution Structure Of The Pdz Domain Of AF-6
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
2EXG Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands…

Browse structure collections

About this viewer

MolViewer shows 1XZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.