1Y19: PDB entry 1Y19
Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Jan 2005.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- Mus musculus
- Chains
- 12
- Atoms
- 10,348
- Mol. weight
- 149.96 kDa
- Released
- 4 Jan 2005
Explore 1Y19 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1Y19 contains 55 α-helices and 48 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C and G: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 642-644 | 3 | 1 |
| α-helix | 646-648 | 3 | |
Chain B: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-284 | 9 | |
| α-helix | 291-303 | 13 | |
| β-strand | 311-318 | 8 | 2 |
| β-strand | 325-332 | 8 | 2 |
| β-strand | 336-340 | 5 | 2 |
| β-strand | 347-352 | 6 | 2 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 2 |
| β-strand | 365-369 | 5 | 2 |
| β-strand | 378-381 | 4 | 2 |
| α-helix | 385-399 | 15 | |
Chain D: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-285 | 10 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-318 | 8 | 1 |
| β-strand | 325-333 | 9 | 1 |
| β-strand | 336-341 | 6 | 1 |
| β-strand | 347-352 | 6 | 1 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 1 |
| β-strand | 365-369 | 5 | 1 |
| β-strand | 378-381 | 4 | 1 |
| α-helix | 385-399 | 15 | |
Chains E, I and K: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 643-644 | 2 | 3 |
| α-helix | 646-648 | 3 | |
Chain F: 9 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-284 | 9 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-317 | 7 | 4 |
| α-helix | 325 | 1 | |
| β-strand | 326-333 | 8 | 4 |
| β-strand | 336-341 | 6 | 4 |
| β-strand | 347-352 | 6 | 4 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 4 |
| β-strand | 365-369 | 5 | 4 |
| β-strand | 378-381 | 4 | 4 |
| α-helix | 385-399 | 15 | |
Chain H: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-285 | 10 | |
| α-helix | 291-303 | 13 | |
| β-strand | 311-317 | 7 | 3 |
| β-strand | 326-332 | 7 | 3 |
| β-strand | 336-340 | 5 | 3 |
| β-strand | 347-352 | 6 | 3 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 3 |
| β-strand | 365-369 | 5 | 3 |
| β-strand | 378-381 | 4 | 3 |
| α-helix | 385-399 | 15 | |
Chain J: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-225 | 16 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-284 | 9 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-318 | 8 | 6 |
| β-strand | 325-332 | 8 | 6 |
| β-strand | 336-341 | 6 | 6 |
| β-strand | 347-352 | 6 | 6 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 6 |
| β-strand | 365-369 | 5 | 6 |
| β-strand | 378-381 | 4 | 6 |
| α-helix | 385-399 | 15 | |
Chain L: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-225 | 16 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-284 | 9 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-318 | 8 | 5 |
| β-strand | 325-332 | 8 | 5 |
| β-strand | 336-340 | 5 | 5 |
| β-strand | 347-352 | 6 | 5 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-361 | 4 | 5 |
| β-strand | 365-369 | 5 | 5 |
| β-strand | 378-381 | 4 | 5 |
| α-helix | 385-399 | 15 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma | A, C, E, G, I, K | protein | 14 | Mus musculus | O70161 (AlphaFold model) |
| Talin 1 | B, D, F, H, J, L | protein | 202 | Mus musculus | P26039 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G, I, K), FASTA
>1Y19_1 Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma (chains A, C, E, G, I, K)
DERSWVYSPLHYSA
Sequence of entity 2 (B, D, F, H, J, L), FASTA
>1Y19_2 Talin 1 (chains B, D, F, H, J, L)
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPK
EYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPR
LLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQI
AQLIAGYIDIILKKKKSKDHFG
Primary citation
Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions. de Pereda, J.M., Wegener, K., Santelli, E. et al. J Biol Chem (2005) 280:8381-8386. DOI 10.1074/jbc.M413180200 · PubMed
Other PDB entries of the same protein (UniProt O70161 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
- 2H7E Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
Browse structure collections
About this viewer
MolViewer shows 1Y19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.