1Y74: MLin-2/mLin-7 L27 Domain Complex

Solution Structure of mLin-2/mLin-7 L27 Domain Complex. Determined by solution NMR. Released 19 Apr 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 4
Atoms: 1,742
Mol. weight: 24.88 kDa
Released: 19 Apr 2005

Explore 1Y74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y74 contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	19-36	18
α-helix	41-52	12
α-helix	54-72	19

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	84-95	12
α-helix	101-111	11
α-helix	113-130	18

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	84-95	12
α-helix	101-111	11
α-helix	113-129	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
lin 7 homolog b	A, C	protein	57	Mus musculus	O88951 (AlphaFold model)
Peripheral plasma membrane protein CASK	B, D	protein	50	Mus musculus	O70589 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1Y74_1 lin 7 homolog b (chains A, C)
LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT

Sequence of entity 2 (B, D), FASTA

>1Y74_2 Peripheral plasma membrane protein CASK (chains B, D)
AVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD

Primary citation

A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins. Feng, W., Long, J.F., Zhang, M. Proc Natl Acad Sci U S A (2005) 102:6861-6866. DOI 10.1073/pnas.0409346102 · PubMed

Other PDB entries of the same protein (UniProt O88951 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UIT 2.05 Å, Overall structure of Patj/Pals1/Mals complex

Browse structure collections

About this viewer

MolViewer shows 1Y74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.