1YGH: Hat domain of GCN5 from saccharomyces cerevisiae

Hat domain of GCN5 from saccharomyces cerevisiae. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Aug 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,930
Mol. weight: 38.68 kDa
Released: 2 Aug 1999

Explore 1YGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YGH contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	100-105	6	1
α-helix	111-127	17
α-helix	133-141	9
β-strand	146-152	7	1
β-strand	156-166	11	1
α-helix	167-169	3
β-strand	171-179	9	1
α-helix	188-203	16
β-strand	208-213	6	1
α-helix	215-217	3
α-helix	218-223	6
β-strand	227	1	1
α-helix	234-237	4
β-strand	238	1	2
β-strand	241	1	2
β-strand	248-253	6	1
α-helix	255-257	3

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	100-105	6	3
α-helix	111-127	17
α-helix	133-141	9
β-strand	146-152	7	3
β-strand	156-166	11	3
α-helix	167-169	3
β-strand	171-179	9	3
α-helix	188-203	16
β-strand	208-213	6	3
α-helix	215-217	3
α-helix	218-223	6
β-strand	227	1	3
α-helix	234-237	4
β-strand	248-253	6	3
α-helix	255-257	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (transcriptional activator GCN5)	A, B	protein	164	Saccharomyces cerevisiae	Q03330 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YGH_1 PROTEIN (TRANSCRIPTIONAL ACTIVATOR GCN5) (chains A, B)
KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVV
GGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAI
GYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD

Primary citation

Crystal structure and mechanism of histone acetylation of the yeast GCN5 transcriptional coactivator. Trievel, R.C., Rojas, J.R., Sterner, D.E. et al. Proc Natl Acad Sci U S A (1999) 96:8931-8936. DOI 10.1073/pnas.96.16.8931 · PubMed

Other PDB entries of the same protein (UniProt Q03330 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E6I 1.87 Å, Bromodomain from GCN5 complexed with acetylated H4 peptide
6CW3 1.98 Å, Crystal structure of a yeast SAGA transcriptional coactivator Ada2/Gcn5 HAT subcomplex,…
6CW2 2.67 Å, Crystal structure of a yeast SAGA transcriptional coactivator Ada2/Gcn5 HAT subcomplex,…

Browse structure collections

About this viewer

MolViewer shows 1YGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.