NMR solution structure of the reduced spinach plastocyanin. Determined by solution NMR. Released 5 Apr 2005.
Explore 1YLB in 3D Show helices and sheets RCSB PDB PDBe
1YLB contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 18 | 1 | 2 |
| β-strand | 21 | 1 | 3 |
| β-strand | 26-31 | 6 | 1 |
| β-strand | 37 | 1 | 4 |
| β-strand | 40-41 | 2 | 2 |
| α-helix | 52-54 | 3 | |
| α-helix | 57-58 | 2 | |
| β-strand | 63 | 1 | 4 |
| β-strand | 69-73 | 5 | 1 |
| β-strand | 79-83 | 5 | 2 |
| β-strand | 93-97 | 5 | 2 |
| β-strand | 98 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plastocyanin, chloroplast | B | protein | 99 | Spinacia oleracea | P00289 (AlphaFold model) |
>1YLB_1 Plastocyanin, chloroplast (chains B) VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEE DLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
| ID | Name | Formula | Copies |
|---|---|---|---|
| CU1 | Copper (I) ion | Cu | 1 |
Structure of the Intermolecular Complex between Plastocyanin and Cytochrome f from Spinach. Musiani, F., Dikiy, A., Semenov, A.Y. et al. J Biol Chem (2005) 280:18833-18841. DOI 10.1074/jbc.M412760200 · PubMed
Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YLB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.