1YYL: CD4M33, a scorpion-toxin mimic of CD4
crystal structure of CD4M33, a scorpion-toxin mimic of CD4, in complex with HIV-1 YU2 gp120 envelope glycoprotein and anti-HIV-1 antibody 17b. Determined by X-ray diffraction at 2.75 Å resolution. Released 3 May 2005.
- Method
- X-ray diffraction
- Resolution
- 2.75 Å
- Organisms
- Human immunodeficiency virus 1, Homo sapiens, synthetic construct
- Chains
- 8
- Atoms
- 12,370
- Mol. weight
- 174.81 kDa
- Ligands
- NAG
- Released
- 3 May 2005
Explore 1YYL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1YYL contains 53 α-helices and 151 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain G: 9 helices, 30 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 91-94 | 4 | 1 |
| α-helix | 99-113 | 15 | |
| β-strand | 120-126 | 7 | 2 |
| β-strand | 196-202 | 7 | 2 |
| β-strand | 215 | 1 | 3 |
| β-strand | 218 | 1 | 4 |
| α-helix | 219-220 | 2 | |
| β-strand | 223-228 | 6 | 5 |
| β-strand | 236-239 | 4 | 1 |
| β-strand | 242-245 | 4 | 5 |
| β-strand | 247 | 1 | 4 |
| β-strand | 251 | 1 | 3 |
| β-strand | 256 | 1 | 6 |
| β-strand | 259-261 | 3 | 7 |
| α-helix | 264-266 | 3 | |
| β-strand | 271-274 | 4 | 7 |
| α-helix | 283 | 1 | |
| β-strand | 284-296 | 13 | 7 |
| β-strand | 330-331 | 2 | 8 |
| β-strand | 332-333 | 2 | 7 |
| β-strand | 334 | 1 | 9 |
| α-helix | 335-353 | 19 | |
| β-strand | 358-361 | 4 | 7 |
| β-strand | 367 | 1 | 10 |
| α-helix | 369-372 | 4 | |
| β-strand | 374-378 | 5 | 6 |
| β-strand | 381-385 | 5 | 6 |
| α-helix | 388-390 | 3 | |
| β-strand | 393-394 | 2 | 7 |
| β-strand | 413 | 1 | 9 |
| β-strand | 416-417 | 2 | 8 |
| β-strand | 418-421 | 4 | 6 |
| β-strand | 423-425 | 3 | 2 |
| β-strand | 432-434 | 3 | 2 |
| α-helix | 435-438 | 4 | |
| β-strand | 445-456 | 12 | 7 |
| β-strand | 465-470 | 6 | 7 |
| α-helix | 475-483 | 9 | |
| β-strand | 486-490 | 5 | 5 |
Chain H: 9 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 16 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 17 |
| β-strand | 18-25 | 8 | 16 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-39 | 8 | 17 |
| β-strand | 46-52 | 7 | 17 |
| β-strand | 56-59 | 4 | 17 |
| β-strand | 67-72 | 6 | 16 |
| β-strand | 77-82 | 6 | 16 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 17 |
| α-helix | 100-100B | 3 | |
| β-strand | 102-103 | 2 | 17 |
| β-strand | 107-111 | 5 | 17 |
| β-strand | 117 | 1 | 18 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 19 |
| β-strand | 135-145 | 11 | 19 |
| β-strand | 146 | 1 | 18 |
| β-strand | 151-154 | 4 | 20 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 20 |
| β-strand | 163-165 | 3 | 19 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 19 |
| β-strand | 176-185 | 10 | 19 |
| α-helix | 186-188 | 3 | |
| β-strand | 195-200 | 6 | 20 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 20 |
Chain L: 7 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 11 |
| β-strand | 10-13 | 4 | 12 |
| β-strand | 19-25 | 7 | 11 |
| β-strand | 33-38 | 6 | 12 |
| β-strand | 45-49 | 5 | 12 |
| β-strand | 53-54 | 2 | 12 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 11 |
| β-strand | 70-75 | 6 | 11 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 12 |
| β-strand | 97-98 | 2 | 12 |
| β-strand | 102-106 | 5 | 12 |
| β-strand | 111 | 1 | 13 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 14 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 14 |
| β-strand | 140 | 1 | 13 |
| β-strand | 144-150 | 7 | 15 |
| β-strand | 154 | 1 | 15 |
| β-strand | 159-163 | 5 | 14 |
| α-helix | 165-167 | 3 | |
| β-strand | 173-182 | 10 | 14 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 15 |
| β-strand | 205-210 | 6 | 15 |
Chain M: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
| β-strand | 17-20 | 4 | 10 |
| β-strand | 23-26 | 4 | 10 |
Chain P: 10 helices, 29 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1091-1094 | 4 | 21 |
| α-helix | 1095-1097 | 3 | |
| α-helix | 1099-1112 | 14 | |
| β-strand | 1120-1126 | 7 | 22 |
| β-strand | 1196-1202 | 7 | 22 |
| β-strand | 1215 | 1 | 23 |
| β-strand | 1218 | 1 | 24 |
| α-helix | 1219-1220 | 2 | |
| β-strand | 1223-1228 | 6 | 25 |
| β-strand | 1236-1239 | 4 | 21 |
| β-strand | 1242-1245 | 4 | 25 |
| β-strand | 1247 | 1 | 24 |
| α-helix | 1248-1250 | 3 | |
| β-strand | 1251 | 1 | 23 |
| β-strand | 1256 | 1 | 26 |
| β-strand | 1259-1261 | 3 | 27 |
| α-helix | 1264-1266 | 3 | |
| β-strand | 1271-1274 | 4 | 27 |
| α-helix | 1283 | 1 | |
| β-strand | 1284-1287 | 4 | 27 |
| β-strand | 1293-1296 | 4 | 28 |
| β-strand | 1330-1334 | 5 | 28 |
| α-helix | 1335-1353 | 19 | |
| β-strand | 1358-1361 | 4 | 27 |
| β-strand | 1367 | 1 | 29 |
| α-helix | 1369-1372 | 4 | |
| β-strand | 1374-1378 | 5 | 26 |
| β-strand | 1381-1385 | 5 | 26 |
| β-strand | 1393 | 1 | 27 |
| β-strand | 1413-1417 | 5 | 28 |
| β-strand | 1420-1421 | 2 | 26 |
| β-strand | 1423-1425 | 3 | 22 |
| β-strand | 1432-1434 | 3 | 22 |
| α-helix | 1435-1438 | 4 | |
| β-strand | 1445-1448 | 4 | 28 |
| β-strand | 1449-1456 | 8 | 27 |
| β-strand | 1465-1470 | 6 | 27 |
| α-helix | 1475-1483 | 9 | |
| β-strand | 1486-1490 | 5 | 25 |
Chain Q: 6 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1004-1007 | 4 | 30 |
| β-strand | 1010-1013 | 4 | 31 |
| β-strand | 1019-1025 | 7 | 30 |
| β-strand | 1033-1038 | 6 | 31 |
| β-strand | 1045-1049 | 5 | 31 |
| β-strand | 1053-1054 | 2 | 31 |
| α-helix | 1055 | 1 | |
| β-strand | 1062-1067 | 6 | 30 |
| β-strand | 1070-1075 | 6 | 30 |
| α-helix | 1080-1082 | 3 | |
| β-strand | 1085-1090 | 6 | 31 |
| β-strand | 1097-1098 | 2 | 31 |
| β-strand | 1102-1106 | 5 | 31 |
| β-strand | 1111 | 1 | 32 |
| β-strand | 1114-1118 | 5 | 33 |
| α-helix | 1119-1121 | 3 | |
| α-helix | 1122-1127 | 6 | |
| β-strand | 1130-1139 | 10 | 33 |
| β-strand | 1140 | 1 | 32 |
| β-strand | 1145-1150 | 6 | 34 |
| β-strand | 1153-1154 | 2 | 34 |
| β-strand | 1159-1163 | 5 | 33 |
| α-helix | 1165-1167 | 3 | |
| β-strand | 1173-1181 | 9 | 33 |
| α-helix | 1183-1187 | 5 | |
| β-strand | 1191-1197 | 7 | 34 |
| β-strand | 1205-1210 | 6 | 34 |
Chain R: 9 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1003-1006 | 4 | 35 |
| β-strand | 1010-1012 | 3 | 36 |
| β-strand | 1017-1025 | 9 | 35 |
| α-helix | 1029-1031 | 3 | |
| β-strand | 1032-1038 | 7 | 37 |
| β-strand | 1046-1052 | 7 | 37 |
| α-helix | 1052A-1054 | 3 | |
| β-strand | 1056-1059 | 4 | 37 |
| β-strand | 1067-1072 | 6 | 35 |
| β-strand | 1077-1082A | 7 | 35 |
| α-helix | 1084-1086 | 3 | |
| β-strand | 1088-1090 | 3 | 36 |
| β-strand | 1091-1096 | 6 | 37 |
| α-helix | 1100-1100B | 3 | |
| β-strand | 1102-1103 | 2 | 37 |
| β-strand | 1107-1111 | 5 | 36 |
| β-strand | 1117 | 1 | 38 |
| α-helix | 1118-1119 | 2 | |
| β-strand | 1120-1124 | 5 | 39 |
| β-strand | 1130 | 1 | 39 |
| β-strand | 1135-1145 | 11 | 39 |
| β-strand | 1146 | 1 | 38 |
| β-strand | 1151-1154 | 4 | 40 |
| α-helix | 1155-1157 | 3 | |
| β-strand | 1159 | 1 | 40 |
| β-strand | 1163-1165 | 3 | 39 |
| α-helix | 1166-1168 | 3 | |
| β-strand | 1169-1170 | 2 | 39 |
| β-strand | 1176-1185 | 10 | 39 |
| α-helix | 1186-1188 | 3 | |
| β-strand | 1194-1200 | 7 | 40 |
| α-helix | 1201-1203 | 3 | |
| β-strand | 1205-1211 | 7 | 40 |
Chain S: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1003-1009 | 7 | |
| α-helix | 1010-1013 | 4 | |
| β-strand | 1017-1020 | 4 | 29 |
| β-strand | 1023-1026 | 4 | 29 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Exterior membrane glycoprotein(GP120),Exterior membrane glycoprotein(GP120),Exterior membrane… | G, P | protein | 313 | Human immunodeficiency virus 1 | P35961 |
| antibody 17b light chain | L, Q | protein | 214 | Homo sapiens | |
| antibody 17b heavy chain | H, R | protein | 229 | Homo sapiens | |
| CD4M33, scorpion-toxin mimic of CD4 | M, S | protein | 27 | synthetic construct | |
Sequence of entity 1 (G, P), FASTA
>1YYL_1 Exterior membrane glycoprotein(GP120),Exterior membrane glycoprotein(GP120),Exterior membrane glycoprotein(GP120) (chains G, P)
GARSEVKLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVGAGSCNTSVIT
QACPKVSFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLN
GSLAEEEIVIRSENFTNNAKTIIVQLNESVVINCTGAGHCNLSKTQWENTLEQIAIKLKE
QFGNNKTIIFNPSSGGDPEIVTHSFNCGGEFFYCNSTQLFTWNDTRKLNNTGRNITLPCR
IKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGKDTNGTEIFRPGGGDMRDNW
RSELYKYKVVKIE
Sequence of entity 2 (L, Q), FASTA
>1YYL_2 antibody 17b light chain (chains L, Q)
DIVMTQSPATLSVSPGERATLSCRASESVSSDLAWYQQKPGQAPRLLIYGASTRATGVPA
RFSGSGSGAEFTLTISSLQSEDFAVYYCQQYNNWPPRYTFGQGTRLEIKRTVAAPSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
Sequence of entity 3 (H, R), FASTA
>1YYL_3 antibody 17b heavy chain (chains H, R)
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHY
APHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Sequence of entity 4 (M, S), FASTA
>1YYL_4 CD4M33, scorpion-toxin mimic of CD4 (chains M, S)
XNLHFCQLRCKSLGLLGKCAGSFCACX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 16 |
Primary citation
Scorpion-toxin mimics of CD4 in complex with human immunodeficiency virus gp120 crystal structures, molecular mimicry, and neutralization breadth. Huang, C.C., Stricher, F., Martin, L. et al. Structure (2005) 13:755-768. DOI 10.1016/j.str.2005.03.006 · PubMed
Other PDB entries of the same protein (UniProt P35961), best resolution first:
- 4JZZ 1.49 Å, Crystal structure of CD4-mimetic miniprotein M48U1 in complex with HIV-1 YU2 gp120 in…
- 4JZW 1.78 Å, Crystal structure of CD4-mimetic miniprotein M48U1 in complex with HIV-1 YU2 gp120 in…
- 4KA2 1.79 Å, Crystal structure of CD4-mimetic miniprotein M48U12 in complex with HIV-1 YU2 gp120
- 4RWY 2.13 Å, Crystal structure of VH1-46 germline-derived CD4-binding site-directed antibody 8ANC131…
- 4K0A 2.13 Å, Crystal structure of CD4-mimetic miniprotein M48U7 in complex with HIV-1 YU2 gp120
- 4LAJ 2.14 Å, Crystal structure of HIV-1 YU2 envelope gp120 glycoprotein in complex with CD4-mimetic…
- 1YYM 2.2 Å, crystal structure of F23, a scorpion-toxin mimic of CD4, in complex with HIV-1 YU2 gp120…
- 2NY7 2.3 Å, HIV-1 gp120 Envelope Glycoprotein Complexed with the Broadly Neutralizing…
- 2I60 2.4 Å, Crystal structure of [Phe23]M47, a scorpion-toxin mimic of CD4, in complex with HIV-1…
- 4DVR 2.5 Å, Crystal structure of YU2 gp120 core in complex with Fab 48d and NBD-557
- 4JO3 2.6 Å, Crystal structure of rabbit mAb R20 Fab in complex with V3 C-terminus of HIV-1 Consensus…
- 1G9N 2.9 Å, HIV-1 YU2 GP120 envelope glycoprotein complexed with CD4 and induced neutralizing…
Browse structure collections
About this viewer
MolViewer shows 1YYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.