1Z08: GppNHp-Bound Rab21 Q53G mutant GTPase

GppNHp-Bound Rab21 Q53G mutant GTPase. Determined by X-ray diffraction at 1.8 Å resolution. Released 26 Jul 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,110
Mol. weight: 79.34 kDa
Ligands: MG, GNP
Released: 26 Jul 2005

Explore 1Z08 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z08 contains 27 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-25	8	1
α-helix	32-41	10
β-strand	55-62	8	1
β-strand	67-74	8	1
β-strand	94-100	7	1
α-helix	104-121	18
α-helix	122-124	3
β-strand	126-132	7	1
α-helix	134-139	6
α-helix	144-153	10
β-strand	157-161	5	1
β-strand	162	1	2
β-strand	167	1	2
α-helix	169-181	13

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-25	8	3
α-helix	32-41	10
β-strand	55-63	9	3
β-strand	66-74	9	3
β-strand	94-100	7	3
α-helix	104-121	18
β-strand	126-132	7	3
α-helix	134-139	6
α-helix	144-153	10
β-strand	157-161	5	3
β-strand	162	1	4
β-strand	167	1	4
α-helix	169-182	14

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-26	9	5
α-helix	32-41	10
β-strand	55-63	9	5
β-strand	66-74	9	5
α-helix	78-83	6
α-helix	86-88	3
β-strand	94-100	7	5
α-helix	104-121	18
α-helix	122-124	3
β-strand	126-132	7	5
α-helix	134-139	6
α-helix	144-153	10
β-strand	157-160	4	5
β-strand	162	1	6
β-strand	167	1	6
α-helix	169-181	13

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	7
α-helix	32-41	10
β-strand	55-63	9	7
β-strand	66-74	9	7
α-helix	78-83	6
α-helix	85-88	4
β-strand	94-100	7	7
α-helix	104-121	18
α-helix	122-124	3
β-strand	126-132	7	7
α-helix	134-139	6
α-helix	144-153	10
β-strand	157-160	4	7
β-strand	162	1	8
β-strand	167	1	8
α-helix	169-182	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-21	A, B, C, D	protein	170	Homo sapiens	Q9UL25 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1Z08_1 Ras-related protein Rab-21 (chains A, B, C, D)
GSRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIW
DTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNK
IDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	8
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	4

Primary citation

Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Eathiraj, S., Pan, X., Ritacco, C. et al. Nature (2005) 436:415-419. DOI 10.1038/nature03798 · PubMed

Other PDB entries of the same protein (UniProt Q9UL25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZT 2.05 Å, GppNHp-Bound Rab21 GTPase at 2.05 A Resolution
2OT3 2.1 Å, Crystal structure of rabex-5 VPS9 domain in complex with nucleotide free RAB21
1Z0I 2.33 Å, GDP-Bound Rab21 GTPase
1YZU 2.5 Å, GppNHp-Bound Rab21 GTPase at 2.50 A Resolution

Browse structure collections

About this viewer

MolViewer shows 1Z08 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.