1Z0I: GDP-Bound Rab21 GTPase

GDP-Bound Rab21 GTPase. Determined by X-ray diffraction at 2.33 Å resolution. Released 26 Jul 2005.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,364
Mol. weight: 19.8 kDa
Ligands: GDP, MG
Released: 26 Jul 2005

Explore 1Z0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z0I contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-25	8	1
α-helix	32-41	10
β-strand	56-63	8	1
β-strand	66-73	8	1
β-strand	94-100	7	1
α-helix	104-108	5
α-helix	110-120	11
β-strand	126-132	7	1
α-helix	134-139	6
α-helix	144-153	10
β-strand	157-161	5	1
β-strand	162	1	2
β-strand	167	1	2
α-helix	169-182	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-21	A	protein	170	Homo sapiens	Q9UL25 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z0I_1 Ras-related protein Rab-21 (chains A)
GSRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIW
DTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNK
IDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Eathiraj, S., Pan, X., Ritacco, C. et al. Nature (2005) 436:415-419. DOI 10.1038/nature03798 · PubMed

Other PDB entries of the same protein (UniProt Q9UL25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Z08 1.8 Å, GppNHp-Bound Rab21 Q53G mutant GTPase
1YZT 2.05 Å, GppNHp-Bound Rab21 GTPase at 2.05 A Resolution
2OT3 2.1 Å, Crystal structure of rabex-5 VPS9 domain in complex with nucleotide free RAB21
1YZU 2.5 Å, GppNHp-Bound Rab21 GTPase at 2.50 A Resolution

Browse structure collections

About this viewer

MolViewer shows 1Z0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.