1Z2X: Mouse Vps29

Crystal structure of mouse Vps29. Determined by X-ray diffraction at 2.22 Å resolution. Released 21 Jun 2005.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,164
Mol. weight: 43.25 kDa
Released: 21 Jun 2005

Explore 1Z2X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z2X contains 7 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	20-23	4
β-strand	33-36	4	1
α-helix	43-52	10
β-strand	55-58	4	1
β-strand	72-77	6	2
β-strand	80-85	6	2
β-strand	92	1	3
α-helix	96-106	11
β-strand	110-113	4	2
β-strand	120-124	5	2
β-strand	127-131	5	2
α-helix	146-148	3
β-strand	149-156	8	1
β-strand	159-168	10	1
β-strand	171-180	10	1

Chain B: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	4
β-strand	11	1	5
α-helix	20-23	4
β-strand	33-36	4	4
β-strand	41	1	5
α-helix	43-52	10
β-strand	55-58	4	4
β-strand	72-77	6	6
β-strand	80-85	6	6
β-strand	90	1	3
α-helix	96-106	11
β-strand	110-113	4	6
β-strand	120-124	5	6
β-strand	127-131	5	6
β-strand	149-156	8	4
β-strand	159-168	10	4
β-strand	171-180	10	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting 29	A, B	protein	192	Mus musculus	Q9QZ88 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Z2X_1 Vacuolar protein sorting 29 (chains A, B)
GSPEFGTRDRMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLK
TLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDI
LISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGD
DVKVERIEYKKS

Primary citation

Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer assembly. Collins, B.M., Skinner, C.F., Watson, P.J. et al. Nat Struct Mol Biol (2005) 12:594-602. DOI 10.1038/nsmb954 · PubMed

Other PDB entries of the same protein (UniProt Q9QZ88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FUD 1.68 Å, Crystal structure of Vps29 in complex with Chaetomium thermophilum Vps5 (71 to 80)
1Z2W 2.0 Å, Crystal structure of mouse Vps29 complexed with Mn2+
8TTD 2.01 Å, Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341)
9O9I 2.35 Å, Crystal structure of mouse Vps29 bound to DENND4C peptide (re-refinement)
3PSN 2.4 Å, Crystal structure of mouse VPS29 complexed with Mn2+
8TTC 3.01 Å, Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302)
3PSO 3.2 Å, Crystal structure of mouse VPS29 complexed with Zn2+
8TTA 3.46 Å, Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341)
6VAB 4.9 Å, Mouse retromer sub-structure: VPS35/VPS35 flat dimer
7U6F 4.9 Å, Mouse retromer (VPS26/VPS35/VPS29) heterotrimers
6VAC 5.7 Å, Mouse retromer (VPS26/VPS35/VPS29) heterotrimer
6TL0 Solution structure and 1H, 13C and 15N chemical shift assignments for the complex of…

Browse structure collections

About this viewer

MolViewer shows 1Z2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.