1Z6C: Vitamin K-dependent protein S

Solution structure of an EGF pair (EGF34) from vitamin K-dependent protein S. Determined by solution NMR. Released 21 Jun 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 664
Mol. weight: 9.68 kDa
Ligands: CA
Released: 21 Jun 2005

Explore 1Z6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z6C contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	171	1	1
β-strand	179	1	2
β-strand	182	1	2
β-strand	192-194	3	1
β-strand	199-201	3	1
α-helix	205-208	4
β-strand	214-215	2	3
β-strand	224-225	2	3
β-strand	233	1	4
β-strand	242	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vitamin K-dependent protein S	A	protein	87	Homo sapiens	P07225 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z6C_1 Vitamin K-dependent protein S (chains A)
KDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNY
PGGYTCYCDGKKGFKLAQDQKSCEVVS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Solution Structure of the Ca(2+)-Binding EGF3-4 Pair from Vitamin K-Dependent Protein S: Identification of an Unusual Fold in EGF3. Drakenberg, T., Ghasriani, H., Thulin, E. et al. Biochemistry (2005) 44:8782-8789. DOI 10.1021/bi050101f · PubMed

Other PDB entries of the same protein (UniProt P07225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9L20 2.82 Å, cryo-EM structure of Vitamin K-dependent gamma-carboxylase complexed with anisindione
9L54 3.04 Å, cryo-EM structure of Vitamin K-dependent gamma-carboxylase complexed with Vitamin K1…

Browse structure collections

About this viewer

MolViewer shows 1Z6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.