Crystal structure of anti-NGF AD11 Fab. Determined by X-ray diffraction at 1.7 Å resolution. Released 4 Apr 2006.
Explore 1ZAN in 3D Show helices and sheets RCSB PDB PDBe
1ZAN contains 16 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 11-12 | 2 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-51 | 7 | 8 |
| β-strand | 57-59 | 3 | 8 |
| α-helix | 64-66 | 3 | |
| β-strand | 67-72 | 6 | 6 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 8 |
| α-helix | 97-99 | 3 | |
| β-strand | 102-103 | 2 | 8 |
| β-strand | 107-109 | 3 | 8 |
| β-strand | 110-111 | 2 | 7 |
| β-strand | 117 | 1 | 9 |
| β-strand | 120-124 | 5 | 10 |
| β-strand | 135-145 | 11 | 10 |
| β-strand | 146 | 1 | 9 |
| β-strand | 151-154 | 4 | 11 |
| α-helix | 155-157 | 3 | |
| β-strand | 163-165 | 3 | 10 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 10 |
| β-strand | 174-184 | 11 | 10 |
| α-helix | 185-190 | 6 | |
| β-strand | 194-199 | 6 | 11 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 112 | 1 | 3 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-119 | 5 | 4 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-126 | 4 | |
| β-strand | 130-140 | 11 | 4 |
| β-strand | 141 | 1 | 3 |
| β-strand | 146-151 | 6 | 5 |
| β-strand | 154-156 | 3 | 5 |
| β-strand | 160-164 | 5 | 4 |
| α-helix | 165-168 | 4 | |
| β-strand | 174-183 | 10 | 4 |
| α-helix | 184-187 | 4 | |
| β-strand | 192-198 | 7 | 5 |
| β-strand | 206-211 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab AD11 Light Chain | L | protein | 214 | Rattus norvegicus | Q4KM66 (AlphaFold model) |
| Fab AD11 Heavy Chain | H | protein | 224 | Rattus norvegicus | P84751 (AlphaFold model) |
>1ZAN_1 Fab AD11 Light Chain (chains L) DIQMTQSPASLSASLGETVTIECRASEDIYNALAWYQQKPGKSPQLLIYNTDTLHTGVPS RFSGSGSGTQYSLKINSLQSEDVASYFCQHYFGYPRTFGGGTKLELKRADAAPTVSIFPP SSEQLASGGASVVCLLNNFYPKDISVKWKIDGSERQNGVLDSVTDQDSKDSTYSMSSTLT LTKAEYESHNSYTCEVTHKTSTSPVVKSFNRGEC
>1ZAN_2 Fab AD11 Heavy Chain (chains H) QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNNVNWVRQATGRGLEWMGGVWAGGATDYN SALKSRLTITRDTSKSQVFLKMHSLQSEDTATYYCARDGGYSSSTLYAMDAWGQGTTVTV SSASTTAPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLASGVHTFPAVLQ SGLYTLSSSVTVPASPWASEAVTCNVAHPASSTKVDKKIVPRDC
Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody. Covaceuszach, S., Cassetta, A., Konarev, P.V. et al. J Mol Biol (2008) 381:881-896. DOI 10.1016/j.jmb.2008.06.008 · PubMed
MolViewer shows 1ZAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.