1ZAN: Anti-NGF AD11 Fab

Crystal structure of anti-NGF AD11 Fab. Determined by X-ray diffraction at 1.7 Å resolution. Released 4 Apr 2006.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 3,631
Mol. weight: 46.93 kDa
Released: 4 Apr 2006

Explore 1ZAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZAN contains 16 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	33-39	7	8
β-strand	45-51	7	8
β-strand	57-59	3	8
α-helix	64-66	3
β-strand	67-72	6	6
α-helix	73-75	3
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-95	8	8
α-helix	97-99	3
β-strand	102-103	2	8
β-strand	107-109	3	8
β-strand	110-111	2	7
β-strand	117	1	9
β-strand	120-124	5	10
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-171	3	10
β-strand	174-184	11	10
α-helix	185-190	6
β-strand	194-199	6	11
α-helix	200-202	3
β-strand	204-209	6	11

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	112	1	3
α-helix	113-114	2
β-strand	115-119	5	4
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	4
β-strand	141	1	3
β-strand	146-151	6	5
β-strand	154-156	3	5
β-strand	160-164	5	4
α-helix	165-168	4
β-strand	174-183	10	4
α-helix	184-187	4
β-strand	192-198	7	5
β-strand	206-211	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab AD11 Light Chain	L	protein	214	Rattus norvegicus	Q4KM66 (AlphaFold model)
Fab AD11 Heavy Chain	H	protein	224	Rattus norvegicus	P84751 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1ZAN_1 Fab AD11 Light Chain (chains L)
DIQMTQSPASLSASLGETVTIECRASEDIYNALAWYQQKPGKSPQLLIYNTDTLHTGVPS
RFSGSGSGTQYSLKINSLQSEDVASYFCQHYFGYPRTFGGGTKLELKRADAAPTVSIFPP
SSEQLASGGASVVCLLNNFYPKDISVKWKIDGSERQNGVLDSVTDQDSKDSTYSMSSTLT
LTKAEYESHNSYTCEVTHKTSTSPVVKSFNRGEC

Sequence of entity 2 (H), FASTA

>1ZAN_2 Fab AD11 Heavy Chain (chains H)
QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNNVNWVRQATGRGLEWMGGVWAGGATDYN
SALKSRLTITRDTSKSQVFLKMHSLQSEDTATYYCARDGGYSSSTLYAMDAWGQGTTVTV
SSASTTAPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLASGVHTFPAVLQ
SGLYTLSSSVTVPASPWASEAVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody. Covaceuszach, S., Cassetta, A., Konarev, P.V. et al. J Mol Biol (2008) 381:881-896. DOI 10.1016/j.jmb.2008.06.008 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1ZAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.