Structural basis of rab effector specificity: crystal structure of the small G protein RAB3A complexed with the effector domain of rabphilin-3A. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Apr 1999.
Explore 1ZBD in 3D Show helices and sheets RCSB PDB PDBe
1ZBD contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-28 | 8 | 1 |
| α-helix | 35-43 | 9 | |
| β-strand | 57-66 | 10 | 1 |
| β-strand | 69-78 | 10 | 1 |
| α-helix | 82-84 | 3 | |
| α-helix | 85-89 | 5 | |
| α-helix | 92-94 | 3 | |
| β-strand | 97-103 | 7 | 1 |
| α-helix | 107-123 | 17 | |
| β-strand | 129-135 | 7 | 1 |
| α-helix | 147-157 | 11 | |
| β-strand | 160-163 | 4 | 1 |
| β-strand | 165 | 1 | 2 |
| β-strand | 170 | 1 | 2 |
| α-helix | 173-189 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 50-84 | 35 | |
| β-strand | 93 | 1 | 3 |
| β-strand | 100 | 1 | 3 |
| β-strand | 108-110 | 3 | 4 |
| β-strand | 117-119 | 3 | 4 |
| β-strand | 123-125 | 3 | 5 |
| α-helix | 133-134 | 2 | |
| β-strand | 135-137 | 3 | 5 |
| α-helix | 138-149 | 12 | |
| α-helix | 152-155 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rabphilin-3A | A | protein | 203 | Rattus norvegicus | P63012 (AlphaFold model) |
| Rabphilin-3A | B | protein | 134 | Rattus norvegicus | P47709 (AlphaFold model) |
>1ZBD_1 RABPHILIN-3A (chains A) GSHMFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQ IWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVG NKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTA DPAVTGAKQGPQLTDQQAPPHQD
>1ZBD_2 RABPHILIN-3A (chains B) GSHMRKQEELTDEEKEIINRVIARAEKMETMEQERIGRLVDRLETMRKNVAGDGVNRCIL CGEQLGMLGSASVVCEDCKKNVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFK GFPKQVLPQPMPIK
Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A. Ostermeier, C., Brunger, A.T. Cell (1999) 96:363-374. DOI 10.1016/S0092-8674(00)80549-8 · PubMed
Other PDB entries of the same protein (UniProt P63012 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZBD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.