Crystal structure of the complex formed beween a group I phospholipase A2 and designed penta peptide Leu-Ala-Ile-Tyr-Ser at 2.6A resolution. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Jun 2005.
Explore 1ZM6 in 3D Show helices and sheets RCSB PDB PDBe
1ZM6 contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 19-22 | 4 | |
| β-strand | 25 | 1 | 1 |
| β-strand | 29 | 1 | 1 |
| α-helix | 40-55 | 16 | |
| β-strand | 70-73 | 4 | 2 |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 85-103 | 19 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 1 |
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phospholipase A2 isoform 3 | A | protein | 119 | Naja sagittifera | P60045 (AlphaFold model) |
| designed penta peptide Leu-Ala-Ile-Tyr-Ser | P | protein | 5 |
>1ZM6_1 Phospholipase A2 isoform 3 (chains A) NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGC RPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDDNYNIDLKARCN
>1ZM6_2 designed penta peptide Leu-Ala-Ile-Tyr-Ser (chains P) LAIYS
Crystal structure of the complex of group I PLA2 with a group II-specific peptide Leu-Ala-Ile-Tyr-Ser (LAIYS) at 2.6 A resolution. Singh, R.K., Singh, N., Jabeen, T. et al. J Drug Target (2005) 13:367-374. DOI 10.1080/10611860500254450 · PubMed
Other PDB entries of the same protein (UniProt P60045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZM6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.